BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20411 (581 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13045| Best HMM Match : Ras (HMM E-Value=0) 152 2e-37 SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) 130 8e-31 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 115 2e-26 SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 4e-22 SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_36483| Best HMM Match : Ras (HMM E-Value=0) 97 7e-21 SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) 95 4e-20 SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_27557| Best HMM Match : Ras (HMM E-Value=0) 94 7e-20 SB_7589| Best HMM Match : Ras (HMM E-Value=0) 93 2e-19 SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 6e-19 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 91 8e-19 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 89 2e-18 SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) 83 2e-16 SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 8e-15 SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 8e-15 SB_8315| Best HMM Match : Ras (HMM E-Value=0) 71 5e-13 SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_10811| Best HMM Match : Ras (HMM E-Value=0) 70 2e-12 SB_44625| Best HMM Match : Ras (HMM E-Value=0) 69 4e-12 SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 65 5e-11 SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) 61 7e-10 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_50523| Best HMM Match : Ras (HMM E-Value=0) 52 3e-07 SB_54971| Best HMM Match : Ras (HMM E-Value=0) 52 3e-07 SB_53183| Best HMM Match : Ras (HMM E-Value=0) 52 5e-07 SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) 51 6e-07 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 49 2e-06 SB_47462| Best HMM Match : Ras (HMM E-Value=0) 49 2e-06 SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) 49 3e-06 SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) 48 4e-06 SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) 48 7e-06 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 46 3e-05 SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) 44 7e-05 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 44 1e-04 SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) 44 1e-04 SB_11757| Best HMM Match : Ras (HMM E-Value=0) 43 2e-04 SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) 42 3e-04 SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) 41 8e-04 SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) 40 0.001 SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8) 40 0.002 SB_33691| Best HMM Match : Ras (HMM E-Value=2.8e-13) 39 0.003 SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) 39 0.003 SB_22529| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) 38 0.005 SB_53421| Best HMM Match : Arf (HMM E-Value=0) 38 0.005 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 38 0.005 SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) 38 0.008 SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_37042| Best HMM Match : Arf (HMM E-Value=0) 36 0.032 SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) 36 0.032 SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22) 35 0.042 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 35 0.042 SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_18358| Best HMM Match : Arf (HMM E-Value=0) 35 0.056 SB_56255| Best HMM Match : Arf (HMM E-Value=0) 34 0.074 SB_22530| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.097 SB_52502| Best HMM Match : GTP_CDC (HMM E-Value=1.9e-06) 33 0.13 SB_51370| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_11310| Best HMM Match : Arf (HMM E-Value=0) 33 0.22 SB_12307| Best HMM Match : Death (HMM E-Value=0.00097) 32 0.39 SB_36446| Best HMM Match : GTP_CDC (HMM E-Value=0) 31 0.52 SB_35222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) 31 0.69 SB_1071| Best HMM Match : Ras (HMM E-Value=0) 31 0.69 SB_38579| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7) 31 0.91 SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) 31 0.91 SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) 30 1.6 SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) 29 2.8 SB_11841| Best HMM Match : Ras (HMM E-Value=0) 29 2.8 SB_10158| Best HMM Match : MMR_HSR1 (HMM E-Value=9.4e-08) 29 2.8 SB_43575| Best HMM Match : Sina (HMM E-Value=0) 29 2.8 SB_16073| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_15868| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_57342| Best HMM Match : Arf (HMM E-Value=0) 29 3.7 SB_53088| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) 28 6.4 SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2) 27 8.5 SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) 27 8.5 SB_27378| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_7886| Best HMM Match : Cbl_N3 (HMM E-Value=4.9) 27 8.5 >SB_13045| Best HMM Match : Ras (HMM E-Value=0) Length = 629 Score = 152 bits (369), Expect = 2e-37 Identities = 70/79 (88%), Positives = 77/79 (97%) Frame = +2 Query: 257 DEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 436 D YDYL+K+VLIGDSGVGKSSLLSRFTRNEF++ESKSTIGVEFATRSI+V+GK IKAQ+W Sbjct: 7 DHYDYLYKIVLIGDSGVGKSSLLSRFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVW 66 Query: 437 DTAGQERYRAITSAYYRGA 493 DTAGQERYRAITSAYYRGA Sbjct: 67 DTAGQERYRAITSAYYRGA 85 Score = 30.3 bits (65), Expect = 1.2 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 510 YDIAKHLSYENVERWLRELRD 572 YD+ K ++++VERWL E+R+ Sbjct: 92 YDLTKQKTFQDVERWLLEVRE 112 >SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) Length = 68 Score = 130 bits (314), Expect = 8e-31 Identities = 62/66 (93%), Positives = 64/66 (96%) Frame = +2 Query: 245 GHKKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIK 424 G K DEYDYLFKVVLIGDSGVGKS+LLSRFTRNEFNLESKSTIGVEFATRSI+VDGKTIK Sbjct: 2 GTKDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIK 61 Query: 425 AQIWDT 442 AQIWDT Sbjct: 62 AQIWDT 67 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 115 bits (277), Expect = 2e-26 Identities = 54/78 (69%), Positives = 64/78 (82%) Frame = +2 Query: 260 EYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWD 439 EYDYLFK++LIGDSGVGKSSLL RF + F+ STIGV+F R++ VDGKTIK QIWD Sbjct: 4 EYDYLFKLLLIGDSGVGKSSLLLRFADDTFSNTYISTIGVDFKIRTLTVDGKTIKLQIWD 63 Query: 440 TAGQERYRAITSAYYRGA 493 TAGQER+R +T+AYYR A Sbjct: 64 TAGQERFRTLTTAYYRSA 81 >SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 109 bits (261), Expect = 2e-24 Identities = 47/64 (73%), Positives = 60/64 (93%) Frame = +2 Query: 254 KDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQI 433 +D YDYLFK+VLIGDSGVGKS+LLSR+T+NEF+L SK+TIGVE A R++E++GKT++AQI Sbjct: 12 EDNYDYLFKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQI 71 Query: 434 WDTA 445 WDTA Sbjct: 72 WDTA 75 >SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 101 bits (242), Expect = 4e-22 Identities = 41/79 (51%), Positives = 60/79 (75%) Frame = +2 Query: 257 DEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 436 D+Y YLFK++L+GD+ VGK+ L+ +FT+ F TIGV+F ++++VDG+ +K QIW Sbjct: 2 DDYSYLFKIILVGDANVGKTCLVRQFTKGYFPPNQGPTIGVDFTIKTVDVDGEKVKLQIW 61 Query: 437 DTAGQERYRAITSAYYRGA 493 DTAGQER+R+IT +YY A Sbjct: 62 DTAGQERFRSITQSYYHNA 80 >SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 98.7 bits (235), Expect = 3e-21 Identities = 57/99 (57%), Positives = 67/99 (67%), Gaps = 21/99 (21%) Frame = +2 Query: 260 EYDYLFKVVLIGDSGVGKSSLLSRFT--------------------RNEFNLESK-STIG 376 EYDYLFK++LIGDSGVGKS LL RF +++ ES STIG Sbjct: 4 EYDYLFKLLLIGDSGVGKSCLLLRFALSLAQKLLLFRIYSHPTLSQQDDTYTESYISTIG 63 Query: 377 VEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGA 493 V+F R+IE+DGKTIK QIWDTAGQER+R ITS+YYRGA Sbjct: 64 VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGA 102 >SB_36483| Best HMM Match : Ras (HMM E-Value=0) Length = 213 Score = 97.5 bits (232), Expect = 7e-21 Identities = 40/76 (52%), Positives = 60/76 (78%) Frame = +2 Query: 266 DYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTA 445 DY+FKV+++GD VGKSSL+ RF +EFN + +TIGV+F ++DGK +K Q+WDTA Sbjct: 8 DYVFKVLVLGDCNVGKSSLIRRFHDDEFNAQLCTTIGVDFFIHDFDLDGKKVKLQLWDTA 67 Query: 446 GQERYRAITSAYYRGA 493 G+E+YRA++ +++RGA Sbjct: 68 GEEKYRALSRSFFRGA 83 >SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) Length = 115 Score = 95.1 bits (226), Expect = 4e-20 Identities = 40/77 (51%), Positives = 58/77 (75%) Frame = +2 Query: 263 YDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 442 +DY+FK+++IG+S VGK+S L R+ + F ST+G++F +++ + K +K QIWDT Sbjct: 18 FDYMFKLLIIGNSAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNDKRVKLQIWDT 77 Query: 443 AGQERYRAITSAYYRGA 493 AGQERYR IT+AYYRGA Sbjct: 78 AGQERYRTITTAYYRGA 94 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 95.1 bits (226), Expect = 4e-20 Identities = 41/79 (51%), Positives = 56/79 (70%) Frame = +2 Query: 257 DEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 436 D Y FKV+++GD GVGK+SL+ RFT+ F S ST+GV+ TR +++ G +K Q W Sbjct: 6 DNCKYSFKVLVVGDPGVGKTSLIRRFTKGYFCDNSSSTVGVDVGTRVLDIHGDRVKLQCW 65 Query: 437 DTAGQERYRAITSAYYRGA 493 DTAGQE++R IT +YYR A Sbjct: 66 DTAGQEKFRGITQSYYRNA 84 >SB_27557| Best HMM Match : Ras (HMM E-Value=0) Length = 184 Score = 94.3 bits (224), Expect = 7e-20 Identities = 45/79 (56%), Positives = 58/79 (73%), Gaps = 1/79 (1%) Frame = +2 Query: 254 KDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKT-IKAQ 430 K +Y Y F+++LIGDS VGKSSLL +FT +F S T+GV+F R +E+ G IK Q Sbjct: 7 KPKYFYQFRIILIGDSTVGKSSLLRQFTEGQFFENSDPTVGVDFHVRVLELKGDVRIKLQ 66 Query: 431 IWDTAGQERYRAITSAYYR 487 IWDTAGQER+R+IT +YYR Sbjct: 67 IWDTAGQERFRSITYSYYR 85 >SB_7589| Best HMM Match : Ras (HMM E-Value=0) Length = 640 Score = 92.7 bits (220), Expect = 2e-19 Identities = 42/98 (42%), Positives = 63/98 (64%) Frame = +2 Query: 200 DRFLTSTTELRINQNGHKKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGV 379 D ++T +N + + + +FK+VL GD+ VGKSS + R RN F+ ST+GV Sbjct: 418 DSISEASTNTALNMSNVDERVPERMFKIVLAGDAAVGKSSFILRLCRNRFHSALNSTLGV 477 Query: 380 EFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGA 493 +F +++ VDGKT Q+WDTAGQER+R+I +Y+R A Sbjct: 478 DFQMKTLVVDGKTYALQLWDTAGQERFRSIAKSYFRKA 515 >SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 91.1 bits (216), Expect = 6e-19 Identities = 39/72 (54%), Positives = 56/72 (77%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 K++++G+SGVGKSSLL RFT + F+ + +TIGV+F +++ V+G K IWDTAGQER Sbjct: 10 KILIVGESGVGKSSLLLRFTDDTFDPDIGATIGVDFKVKTLTVEGNKAKLAIWDTAGQER 69 Query: 458 YRAITSAYYRGA 493 +R +T +YYRGA Sbjct: 70 FRTLTPSYYRGA 81 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 90.6 bits (215), Expect = 8e-19 Identities = 40/75 (53%), Positives = 56/75 (74%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 454 FK+VL+G+S VGKSSL+ RF + +F+ +STIG F T+++ +D T+K +IWDTAGQE Sbjct: 22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQE 81 Query: 455 RYRAITSAYYRGAWA 499 RY ++ YYRGA A Sbjct: 82 RYHSLAPMYYRGAQA 96 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 89.0 bits (211), Expect = 2e-18 Identities = 40/74 (54%), Positives = 55/74 (74%) Frame = +2 Query: 272 LFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 451 +FKVV IGDSGVGKSS L RF +++ +TIGV+F +++ V+G+ I Q+WDTAGQ Sbjct: 896 VFKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLWDTAGQ 955 Query: 452 ERYRAITSAYYRGA 493 ER+R+IT Y+R A Sbjct: 956 ERFRSITKQYFRKA 969 >SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) Length = 212 Score = 82.6 bits (195), Expect = 2e-16 Identities = 35/76 (46%), Positives = 52/76 (68%) Frame = +2 Query: 272 LFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 451 LFKVVL+G++GVGK+SL R N F ++TIG++ ++ +++ K + +WDTAG Sbjct: 11 LFKVVLLGEAGVGKTSLFYRLKENHFTPGRRNTIGIDSCSKFVKIGEKQVTLSVWDTAGV 70 Query: 452 ERYRAITSAYYRGAWA 499 ER+R +T YYRGA A Sbjct: 71 ERFRTVTKNYYRGAHA 86 >SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 81.8 bits (193), Expect = 4e-16 Identities = 34/69 (49%), Positives = 52/69 (75%) Frame = +2 Query: 287 LIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRA 466 L D GVGKSSL++RF +F+ +S TIGVEF + +++DG++ QIWDTAGQER+++ Sbjct: 216 LSSDGGVGKSSLMNRFVCGKFDTQSFHTIGVEFLNKDVKLDGESYTLQIWDTAGQERFKS 275 Query: 467 ITSAYYRGA 493 + + +YRG+ Sbjct: 276 LRTPFYRGS 284 >SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 77.4 bits (182), Expect = 8e-15 Identities = 34/72 (47%), Positives = 53/72 (73%), Gaps = 1/72 (1%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 454 FK+++IGDS VGK+ L R +F +++TIGV+F +S+E++G+ +K Q+WDTAGQE Sbjct: 47 FKIIIIGDSNVGKTCLAYRLCTGKFPERTETTIGVDFWEKSLELNGEFVKLQLWDTAGQE 106 Query: 455 RYR-AITSAYYR 487 R+R ++ YYR Sbjct: 107 RFRKSMVCHYYR 118 >SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 77.4 bits (182), Expect = 8e-15 Identities = 34/74 (45%), Positives = 51/74 (68%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 K+V +GD GVGKSSL RF + F + + TIG++F T+++ +D ++ QIWDTAGQER Sbjct: 165 KIVFLGDQGVGKSSLAGRFIYDIFEEKYQPTIGIDFMTKTVLLDDFEVRLQIWDTAGQER 224 Query: 458 YRAITSAYYRGAWA 499 +R + +Y R + A Sbjct: 225 FRCLIHSYIRDSEA 238 >SB_8315| Best HMM Match : Ras (HMM E-Value=0) Length = 565 Score = 71.3 bits (167), Expect = 5e-13 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 11/87 (12%) Frame = +2 Query: 266 DYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSI-----------EVDG 412 ++L K + +GDSGVGK+SLL ++T + FN TIG++F + + G Sbjct: 104 EFLIKFLALGDSGVGKTSLLYQYTDSHFNPRFVPTIGIDFREKRVVHHPLNPDGERSTRG 163 Query: 413 KTIKAQIWDTAGQERYRAITSAYYRGA 493 + I Q+WDTAGQER+R++T+A++R A Sbjct: 164 QRIHLQLWDTAGQERFRSLTTAFFRDA 190 >SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 70.9 bits (166), Expect = 7e-13 Identities = 34/80 (42%), Positives = 52/80 (65%), Gaps = 1/80 (1%) Frame = +2 Query: 257 DEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIE-VDGKTIKAQI 433 ++Y FKV+++GD GK S + R+ N ++ K TIGV+FA ++I+ TI+ QI Sbjct: 13 NQYTRNFKVLVVGDILTGKQSFVKRYVNNIWHPLYKPTIGVDFALKTIQWAQNTTIRLQI 72 Query: 434 WDTAGQERYRAITSAYYRGA 493 W AGQER+ ++T YY+GA Sbjct: 73 WLIAGQERFSSMTRVYYKGA 92 >SB_10811| Best HMM Match : Ras (HMM E-Value=0) Length = 304 Score = 69.7 bits (163), Expect = 2e-12 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 356 ESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGA 493 +S TIGVEF ++ + V GK++K QIWDTAGQER+R++T +YYRGA Sbjct: 123 DSSHTIGVEFGSKIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGA 168 >SB_44625| Best HMM Match : Ras (HMM E-Value=0) Length = 128 Score = 68.5 bits (160), Expect = 4e-12 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +2 Query: 365 STIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRG 490 +TIGV+F R+I +DG+ +K QIWDTAGQER+R ITS YYRG Sbjct: 8 TTIGVDFKIRTINIDGEKVKLQIWDTAGQERFRTITSTYYRG 49 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 64.9 bits (151), Expect = 5e-11 Identities = 35/82 (42%), Positives = 51/82 (62%), Gaps = 2/82 (2%) Frame = +2 Query: 251 KKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLES-KSTIGV-EFATRSIEVDGKTIK 424 ++ +DY FK ++IG+SGVGKS L+++ F+L+ ST+ + + D K IK Sbjct: 343 RQPNWDYEFKTLIIGNSGVGKSCLVNKLKNPHFDLKFVTSTVSMNDIFWEYFLYDNKKIK 402 Query: 425 AQIWDTAGQERYRAITSAYYRG 490 I DTAGQERY +I AY+RG Sbjct: 403 LTIGDTAGQERYFSILPAYFRG 424 >SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) Length = 506 Score = 60.9 bits (141), Expect = 7e-10 Identities = 27/68 (39%), Positives = 46/68 (67%) Frame = +2 Query: 281 VVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERY 460 V+L+GDS GK++LL+ + RN+FN + ++T+ +T ++EVDG+ I+ +WDT+G E Y Sbjct: 235 VILVGDSECGKTALLNAYVRNQFNEKYEATVFNSLST-AVEVDGERIELTLWDTSGHEDY 293 Query: 461 RAITSAYY 484 + Y Sbjct: 294 DHVRPLSY 301 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 53.6 bits (123), Expect = 1e-07 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 K+V++GD GVGKS+ L T N F E T+ +++ +I +DGK +WDTAGQE Sbjct: 7 KLVVVGDGGVGKSAFLITATTNAFPGEYIPTVFDNYSS-NIMLDGKAYNVGLWDTAGQED 65 Query: 458 YRAITSAYY 484 Y + Y Sbjct: 66 YDRLRPLSY 74 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 53.2 bits (122), Expect = 1e-07 Identities = 26/69 (37%), Positives = 40/69 (57%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 K+V++GD GK+ LL F++++F T+ + IEVDGK ++ +WDTAGQE Sbjct: 5931 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVA-DIEVDGKQVELALWDTAGQED 5989 Query: 458 YRAITSAYY 484 Y + Y Sbjct: 5990 YDRLRPLSY 5998 >SB_50523| Best HMM Match : Ras (HMM E-Value=0) Length = 154 Score = 52.4 bits (120), Expect = 3e-07 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = +2 Query: 410 GKTIKAQIWDTAGQERYRAITSAYYRGA 493 GK IK QIWDTAGQER+ IT+AYYRGA Sbjct: 2 GKKIKLQIWDTAGQERFHTITTAYYRGA 29 >SB_54971| Best HMM Match : Ras (HMM E-Value=0) Length = 239 Score = 52.0 bits (119), Expect = 3e-07 Identities = 23/65 (35%), Positives = 34/65 (52%) Frame = +2 Query: 290 IGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAI 469 +GD G GK++ + R EF + +T+GVE IK +WDTAGQE++ + Sbjct: 38 VGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLIFFTSRGPIKFNVWDTAGQEKFGGL 97 Query: 470 TSAYY 484 YY Sbjct: 98 RDGYY 102 >SB_53183| Best HMM Match : Ras (HMM E-Value=0) Length = 834 Score = 51.6 bits (118), Expect = 5e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +2 Query: 254 KDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTI 373 K YDYLFK++LIGDSGVGK+ +L RF+ + FN STI Sbjct: 3 KKSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTI 42 >SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) Length = 159 Score = 51.2 bits (117), Expect = 6e-07 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = +2 Query: 266 DYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFA-TRSIEVDGKTIKAQIWDT 442 D ++K+ L G GVGK+S+ +R + +EF E +S ++ + + K +K +WDT Sbjct: 6 DEVYKIALCGKMGVGKTSIYTRLSTDEFPEEEQSLHHIDQCFIPLVCICNKKLKIHLWDT 65 Query: 443 AGQERYRAITSAYY 484 G E Y ++T +Y Sbjct: 66 LGMEEYESLTRNHY 79 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 49.2 bits (112), Expect = 2e-06 Identities = 25/79 (31%), Positives = 44/79 (55%) Frame = +2 Query: 251 KKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQ 430 ++ + D +K+V++G GVGKS+L +F ++ F + TI + + + +D + Sbjct: 4 EQKDVDKQYKLVVVGGGGVGKSALTIQFIQSHFVSDYDPTIEDSYRKQCV-IDERVAHLD 62 Query: 431 IWDTAGQERYRAITSAYYR 487 I DTAGQE + A+ Y R Sbjct: 63 ILDTAGQEEFSAMREQYMR 81 >SB_47462| Best HMM Match : Ras (HMM E-Value=0) Length = 385 Score = 49.2 bits (112), Expect = 2e-06 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 454 +KVV++G GVGKS+L +F +F + TI +F + IEVD +I DTAG E Sbjct: 4 YKVVVLGSGGVGKSALTVQFVTGQFVEKYDPTI-EDFYRKEIEVDNNPSILEILDTAGTE 62 Query: 455 RYRAITSAYYR 487 ++ ++ Y + Sbjct: 63 QFASMRDLYIK 73 >SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) Length = 243 Score = 48.8 bits (111), Expect = 3e-06 Identities = 32/83 (38%), Positives = 44/83 (53%), Gaps = 9/83 (10%) Frame = +2 Query: 266 DYLFKVVLIGD-SGVGKSS-LLSRFTRNE-FNLESKSTIGVEFATRSIE---VDGK---T 418 D+ FK++ +GD +G GK LS + N + K TIGV+F IE D K T Sbjct: 48 DHTFKIMCVGDYTGFGKKGGFLSDYIHNRPLSFYQKPTIGVDFYVHFIEWRETDKKKDST 107 Query: 419 IKAQIWDTAGQERYRAITSAYYR 487 +K Q WD A ER+ +T+ Y R Sbjct: 108 VKLQFWDVAEHERFLKMTAVYCR 130 >SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) Length = 263 Score = 48.4 bits (110), Expect = 4e-06 Identities = 24/62 (38%), Positives = 40/62 (64%) Frame = +2 Query: 266 DYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTA 445 D+++++ L+GD GVGK++LL RF + F E TI ++ +SI +D T+ +I DTA Sbjct: 3 DHVYRIALLGDEGVGKTALLVRFLCHRFLGEYDPTIEDKY-RKSINIDDVTVTLEILDTA 61 Query: 446 GQ 451 + Sbjct: 62 SR 63 >SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) Length = 1265 Score = 47.6 bits (108), Expect = 7e-06 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +3 Query: 510 YDIAKHLSYENVERWLRELRD 572 YDIAKHL+YENVERWL+ELRD Sbjct: 13 YDIAKHLTYENVERWLKELRD 33 >SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) Length = 357 Score = 45.6 bits (103), Expect = 3e-05 Identities = 26/72 (36%), Positives = 36/72 (50%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 KVVL GD+ VGK+S L T+NE LE T + +EV + +WDT G Sbjct: 8 KVVLTGDNNVGKTSFLINLTQNE--LEGTPTAFANYEL-GLEVGSQKFLLDLWDTEGTTE 64 Query: 458 YRAITSAYYRGA 493 Y + Y+G+ Sbjct: 65 YDRLRPLTYQGS 76 >SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 45.6 bits (103), Expect = 3e-05 Identities = 24/69 (34%), Positives = 38/69 (55%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 K V++GD VGK+ LL +T N+F E T+ +A ++ + G+ ++DTAGQE Sbjct: 5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63 Query: 458 YRAITSAYY 484 Y + Y Sbjct: 64 YDRLRPLSY 72 >SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) Length = 241 Score = 44.4 bits (100), Expect = 7e-05 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +2 Query: 419 IKAQIWDTAGQERYRAITSAYYR 487 +K QIWDTAGQER+R IT +YYR Sbjct: 95 VKLQIWDTAGQERFRTITQSYYR 117 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/36 (47%), Positives = 28/36 (77%) Frame = +2 Query: 266 DYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTI 373 +YLFKV++IGD GVGK+SL+ R+ F++ ++T+ Sbjct: 669 EYLFKVLVIGDLGVGKTSLIKRYVHQFFSVHYRATV 704 >SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) Length = 965 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/60 (38%), Positives = 35/60 (58%) Frame = +2 Query: 272 LFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 451 + KVV+IG+ GVGKS+L RF F E T+ + + EV G+ + ++ DTAG+ Sbjct: 861 IVKVVIIGEDGVGKSALTVRFLTKRFIGEYDDTLESTY-RQDAEVAGEVVAIELTDTAGE 919 >SB_11757| Best HMM Match : Ras (HMM E-Value=0) Length = 211 Score = 42.7 bits (96), Expect = 2e-04 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 2/74 (2%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATR--SIEVDGKTIKAQIWDTAGQ 451 K V++GD GVGK+SLL + + F S + F T ++EV+ K + DTAGQ Sbjct: 20 KCVIVGDGGVGKTSLLVSYMMDGF---PNSYVPTAFDTYHVTVEVNKKLCMIEFCDTAGQ 76 Query: 452 ERYRAITSAYYRGA 493 E + A+ Y A Sbjct: 77 EDFDALRPLCYSSA 90 >SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) Length = 92 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/71 (33%), Positives = 37/71 (52%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 K+ ++G VGKSSL +F +F TI F T++I+ G+ ++ DTAGQ+ Sbjct: 8 KIAVMGFRSVGKSSLTIQFVEGQFVDSYDPTIENTF-TKNIKYKGQEFFLELVDTAGQDE 66 Query: 458 YRAITSAYYRG 490 Y +Y G Sbjct: 67 YSIFPQSYSMG 77 >SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.5 bits (93), Expect = 5e-04 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +2 Query: 407 DGKTIKAQIWDTAGQERYRAITSAYYR 487 +G+ I+ +WDTAGQE + AIT AYYR Sbjct: 30 NGEDIRLMLWDTAGQEEFDAITKAYYR 56 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +2 Query: 251 KKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVE 382 ++++ + KVV++G+ VGKSS++ + L T G E Sbjct: 2 REEDVEVAIKVVVVGNGAVGKSSMIQSANGEDIRLMLWDTAGQE 45 >SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 40.7 bits (91), Expect = 8e-04 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = +2 Query: 227 LRINQNGHKKDEYDYLFKVVLIGDSGVGKSSLLSRF-TRNEFNLESKSTIGVEFATRSIE 403 L I +GH +Y KVVL+GD+GVGKS ++ R + +E S+ S Sbjct: 2 LSITSSGHTYKQY----KVVLVGDAGVGKSFVIDRLNSTSEHWQGSRLYKPTTGGHASYF 57 Query: 404 VDGKTIKAQIWDTAGQERYRAITSAYYR 487 + + DT+G E YR +T Y + Sbjct: 58 TASNSCHLYLLDTSGLEEYRELTKIYLK 85 >SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) Length = 421 Score = 40.7 bits (91), Expect = 8e-04 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +2 Query: 404 VDGKTIKAQIWDTAGQERYRAITSAYYRGAWA 499 V+ K K IWDTAGQER++++ YYR A A Sbjct: 4 VNDKAYKFNIWDTAGQERFKSLAPLYYRDAAA 35 >SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) Length = 351 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = +2 Query: 272 LFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKA--QIWDTA 445 +F+VV++G GVGK+SL+ RF F+ + T+G + +S+ + K A +I DTA Sbjct: 107 VFRVVVLGSGGVGKTSLVKRFISGTFSEQYTPTVG-DLYEKSVTL-SKDFNAFLEIMDTA 164 Query: 446 GQERYRAI 469 G + A+ Sbjct: 165 GSYPFPAM 172 >SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 5/76 (6%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEV-----DGKTIKAQIWDT 442 ++ ++GDSGVGK+SL+ E + TIG + + GKT + WD Sbjct: 8 RIAVVGDSGVGKTSLVHLICHEESISSAAWTIGCTVEVKLYDYKEGMPGGKTFFLEFWDI 67 Query: 443 AGQERYRAITSAYYRG 490 G + S +Y G Sbjct: 68 GGSANHENSRSIFYNG 83 >SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8) Length = 65 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/45 (44%), Positives = 26/45 (57%) Frame = +2 Query: 242 NGHKKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIG 376 N + + DYL KV+LIGDS VGK+ LL F E ++ T G Sbjct: 2 NMKPRKKQDYLLKVLLIGDSNVGKTKLLLTFLGQESIVQQMPTAG 46 >SB_33691| Best HMM Match : Ras (HMM E-Value=2.8e-13) Length = 270 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/58 (34%), Positives = 34/58 (58%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 448 +K+ ++G GVGK+SLL F ++F+ + T+ ++ S+ +DG I DTAG Sbjct: 13 YKISILGAGGVGKTSLLKTFFGHKFSEKHVPTVD-DYFIHSVNMDGVYYSTCIVDTAG 69 >SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) Length = 811 Score = 38.7 bits (86), Expect = 0.003 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEF--NLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 451 K+VL+G+SG GK+S E + T+GV +E DG ++ Q+ D AGQ Sbjct: 262 KLVLLGESGAGKTSCAHGLVECEAINQTLNDGTVGVVIRNWQVEPDG--LEVQVVDCAGQ 319 Query: 452 ERYR 463 RY+ Sbjct: 320 RRYQ 323 >SB_22529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/63 (34%), Positives = 34/63 (53%) Frame = +2 Query: 260 EYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWD 439 E D KVV +GD VGK+S L T + F ++I + ++++E+DGK + D Sbjct: 5 ELDPTIKVVFVGDKNVGKTSFLYAATTHNFPTGFIASI-FDGYSKTMEIDGKRYTVLLCD 63 Query: 440 TAG 448 T G Sbjct: 64 TPG 66 >SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) Length = 260 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/71 (29%), Positives = 37/71 (52%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 ++ L+G GK++ ++ +F+ + T+G F R + TIK +WD GQ R Sbjct: 22 ELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVG--FNMRKVSKGNVTIK--VWDIGGQPR 77 Query: 458 YRAITSAYYRG 490 +R++ Y RG Sbjct: 78 FRSMWERYCRG 88 >SB_53421| Best HMM Match : Arf (HMM E-Value=0) Length = 625 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/68 (32%), Positives = 34/68 (50%) Frame = +2 Query: 287 LIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRA 466 +IG GK+++L R E + + T+G T V K I +WD GQ++ RA Sbjct: 1 MIGLDNAGKTTILYRLKLEEV-VSTVPTLGFNVET----VTYKNISFTVWDIGGQDKIRA 55 Query: 467 ITSAYYRG 490 + YY+G Sbjct: 56 LWRVYYQG 63 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/63 (34%), Positives = 33/63 (52%) Frame = +2 Query: 272 LFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 451 +F++ ++G GVGKSS+ R+ +NEF I+ GK ++ DTAGQ Sbjct: 2598 MFRLCVVGSGGVGKSSVTIRYLKNEFT--------------EIDYCGKLYDIEVVDTAGQ 2643 Query: 452 ERY 460 E Y Sbjct: 2644 EEY 2646 >SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +2 Query: 266 DYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIG 376 + LFKV+++GD+ VGK+S + R+ E K TIG Sbjct: 20 EILFKVLIVGDATVGKTSFVQRYVHGNTRREYKPTIG 56 >SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) Length = 145 Score = 37.5 bits (83), Expect = 0.008 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = +2 Query: 431 IWDTAGQERYRAITSAYYRGA 493 IWDTAGQER++++ A+YRGA Sbjct: 1 IWDTAGQERFQSLGVAFYRGA 21 >SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 37.1 bits (82), Expect = 0.010 Identities = 27/85 (31%), Positives = 41/85 (48%) Frame = +2 Query: 191 LETDRFLTSTTELRINQNGHKKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKST 370 L + R L ++T N+ +D + +VL+G +GVGKS+LL RF F E T Sbjct: 105 LTSSRLLNNSTSTLPNRRFPLRD-----YSLVLLGQAGVGKSALLVRFCTGRFIHEYDPT 159 Query: 371 IGVEFATRSIEVDGKTIKAQIWDTA 445 + + + S +D I DTA Sbjct: 160 LEMTYDV-SATIDEDPATLHITDTA 183 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 +++++G G GKS LS ++ + + +T F + DG + IW+ G E+ Sbjct: 168 RILVLGLDGSGKSVFLSALSQGDSSKRPSTTKTEGFNVVCLTTDG--LNLNIWEIGGDEK 225 Query: 458 YRA 466 YRA Sbjct: 226 YRA 228 >SB_37042| Best HMM Match : Arf (HMM E-Value=0) Length = 188 Score = 35.5 bits (78), Expect = 0.032 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 ++V++G GK+++L + E + + TIG T K + IWD GQ++ Sbjct: 21 RIVMLGLDAAGKTTILYKLKLKE-TVSTIPTIGFNVETLQ---PTKNVTLTIWDVGGQDK 76 Query: 458 YRAITSAYYRG 490 R + Y++G Sbjct: 77 IRPLWRHYFQG 87 >SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) Length = 517 Score = 35.5 bits (78), Expect = 0.032 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 434 WDTAGQERYRAITSAYYRGA 493 W+ AGQER+R ITS+YYRGA Sbjct: 374 WE-AGQERFRTITSSYYRGA 392 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 510 YDIAKHLSYENVERWLREL 566 YDI K SY N+ +WL E+ Sbjct: 399 YDITKRESYNNLHKWLMEV 417 >SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22) Length = 159 Score = 35.1 bits (77), Expect = 0.042 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 449 QERYRAITSAYYRGA 493 QERYRAITSAYYRGA Sbjct: 2 QERYRAITSAYYRGA 16 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 510 YDIAKHLSYENVERWLRELR 569 YDIAK S+ N+ +W+ ELR Sbjct: 23 YDIAKGTSFMNLNKWVEELR 42 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 35.1 bits (77), Expect = 0.042 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 449 QERYRAITSAYYRGA 493 QERYRAITSAYYRGA Sbjct: 2 QERYRAITSAYYRGA 16 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 510 YDIAKHLSYENVERWLRELR 569 YDIAK S+ N+ +W+ ELR Sbjct: 23 YDIAKGTSFMNLNKWVEELR 42 >SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 34.7 bits (76), Expect = 0.056 Identities = 19/70 (27%), Positives = 37/70 (52%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 +++++G GK+++L + E + + TIG F S+E K I +WD GQ++ Sbjct: 19 RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVESVEY--KNISFTVWDVGGQDK 73 Query: 458 YRAITSAYYR 487 R + Y++ Sbjct: 74 IRPLWRHYFQ 83 >SB_18358| Best HMM Match : Arf (HMM E-Value=0) Length = 214 Score = 34.7 bits (76), Expect = 0.056 Identities = 23/71 (32%), Positives = 36/71 (50%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 454 F VV++G GK+S+L R N+F + F +I K I+ ++WD G+E Sbjct: 22 FHVVMLGLDKSGKTSILYR---NKFREYVNTVPTTAFNVETIR-PFKGIRFKVWDIGGRE 77 Query: 455 RYRAITSAYYR 487 + R + AY R Sbjct: 78 QNRPLWKAYAR 88 >SB_56255| Best HMM Match : Arf (HMM E-Value=0) Length = 181 Score = 34.3 bits (75), Expect = 0.074 Identities = 18/70 (25%), Positives = 36/70 (51%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 +++++G GK+++L + E + + TIG T V+ K I +WD GQ++ Sbjct: 19 RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIGFNVET----VEYKNISFTVWDVGGQDK 73 Query: 458 YRAITSAYYR 487 R + Y++ Sbjct: 74 IRPLWRHYFQ 83 >SB_22530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 33.9 bits (74), Expect = 0.097 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +2 Query: 266 DYL-FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 442 DY+ K+ ++GD VGK++L N F E T VDG +A ++D+ Sbjct: 3 DYVTLKLYIVGDGAVGKTALFITAATNTFPTEYIPTAYDASEQDFFNVDGIKYQAVLFDS 62 Query: 443 AGQERY 460 AG E + Sbjct: 63 AGGEDF 68 >SB_52502| Best HMM Match : GTP_CDC (HMM E-Value=1.9e-06) Length = 101 Score = 33.5 bits (73), Expect = 0.13 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 9/80 (11%) Frame = +2 Query: 236 NQNGHKKDEYDYLFKVVLIGDSGVGKSSLLSRF-------TRNEFNLES--KSTIGVEFA 388 NQ K + + F ++++G+SG+GKS+L+ R + E K T+ +E + Sbjct: 12 NQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERIKKTVKIETS 71 Query: 389 TRSIEVDGKTIKAQIWDTAG 448 T IE G ++ + DT G Sbjct: 72 TVEIEERGVKLRLTVVDTPG 91 >SB_51370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +2 Query: 281 VVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 451 V ++G GVGKS+ R F E + + + S+E+DG+ + + DTAG+ Sbjct: 184 VAVLGKDGVGKSAFTVRALTRRFIGEYDPFLELNYK-HSMEIDGQYLALDVLDTAGK 239 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +2 Query: 269 YLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVD--GKTIKAQIWDT 442 Y K++L+G GK++L+ R + + +T G+ ++ D + +IWD Sbjct: 550 YSMKLMLVGREAQGKTTLMHRLMLDNTYFINSATNGISMEEFRLKKDFLHREFIFKIWDF 609 Query: 443 AGQERYRA 466 GQE Y A Sbjct: 610 GGQEDYYA 617 >SB_11310| Best HMM Match : Arf (HMM E-Value=0) Length = 255 Score = 32.7 bits (71), Expect = 0.22 Identities = 18/70 (25%), Positives = 36/70 (51%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 457 +++++G GK+++L +E + + TIG V+ K IK +WD GQ++ Sbjct: 92 RLLMVGLDAAGKTTILYHLKLDE-PVNTIPTIGFNVEV----VEYKNIKFTVWDIGGQDK 146 Query: 458 YRAITSAYYR 487 R + Y++ Sbjct: 147 IRLLWRLYFQ 156 >SB_12307| Best HMM Match : Death (HMM E-Value=0.00097) Length = 1366 Score = 31.9 bits (69), Expect = 0.39 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 269 YLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIK 424 Y +++LIG GK+SL F+ + +ST G+E EVD + ++ Sbjct: 360 YRGRIMLIGQDRAGKTSLKKSLLGLRFDPQEESTEGIEVDPSRFEVDVEQVR 411 >SB_36446| Best HMM Match : GTP_CDC (HMM E-Value=0) Length = 384 Score = 31.5 bits (68), Expect = 0.52 Identities = 18/63 (28%), Positives = 33/63 (52%) Frame = +2 Query: 236 NQNGHKKDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGK 415 NQ K + + F V+++G+SG+GKS+LL+ + S E +++EV Sbjct: 12 NQVFRKSVKKGFEFTVMVVGESGLGKSTLLNSLFLTDLYTPSSYPSIKEKLNKTVEVKPC 71 Query: 416 TIK 424 T++ Sbjct: 72 TVE 74 >SB_35222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 31.1 bits (67), Expect = 0.69 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSR--FTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWD 439 ++V++GDS VGK+ LL + + N + + +I + +I VDGK K ++ D Sbjct: 20 RIVILGDSTVGKTCLLLQLCYKSNTMSRKHLESISNNYVA-NIIVDGKVYKLELCD 74 >SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) Length = 284 Score = 31.1 bits (67), Expect = 0.69 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIG 376 +VV++G GVGKS+L R F E ST+G Sbjct: 18 RVVVLGQDGVGKSALTVRLLTKRFIGEYDSTLG 50 >SB_1071| Best HMM Match : Ras (HMM E-Value=0) Length = 228 Score = 31.1 bits (67), Expect = 0.69 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIE 403 +KVV++G GVGKS+L +F +F + TI + T E Sbjct: 4 YKVVVLGSGGVGKSALTVQFVTGQFVEKYDPTIEDFYHTAGTE 46 >SB_38579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 30.7 bits (66), Expect = 0.91 Identities = 13/57 (22%), Positives = 32/57 (56%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTA 445 +K+ ++GD+ GK+SLL+ +++ +E + T+ E + ++ +WD++ Sbjct: 62 YKLSVVGDAESGKTSLLNALVKSD--IEVEETVIFEECVTDVTSGDSNLEFMLWDSS 116 >SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7) Length = 368 Score = 30.7 bits (66), Expect = 0.91 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIG 376 + +V++G +GVGK++L+ RF F E T+G Sbjct: 325 YSMVVLGAAGVGKTALVVRFVTGRFLNEYDPTLG 358 >SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) Length = 244 Score = 30.7 bits (66), Expect = 0.91 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 442 FK+ ++G S VGK+SL+ + F E TI ++ ++ DG + DT Sbjct: 188 FKMAILGGSAVGKTSLMRALFKKPFTNEHIPTID-DYIIHALNQDGVHYNVCLVDT 242 >SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1420 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +2 Query: 269 YLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIK 424 Y +++LIG GK+SL F+ ST G+E + EVD +K Sbjct: 358 YRGRIMLIGQDRAGKTSLKKSLLGLPFDPREVSTEGIEVDPSTFEVDIDQVK 409 >SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) Length = 1243 Score = 29.9 bits (64), Expect = 1.6 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 13/79 (16%) Frame = +2 Query: 269 YLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVD------------- 409 Y K++++G G GK++LL+ + ST+G+ S+++ Sbjct: 665 YRMKLMVVGIQGYGKTTLLAALKGQPLP-SNLSTVGIVVDEWSVQISTSLLSRIGITSGI 723 Query: 410 GKTIKAQIWDTAGQERYRA 466 G TI WD AGQ Y A Sbjct: 724 GPTITLSTWDLAGQSVYYA 742 >SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/18 (55%), Positives = 18/18 (100%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSR 331 K+VL+GD+G+GKS+L+++ Sbjct: 7 KLVLVGDAGIGKSTLIAK 24 >SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) Length = 762 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 418 HKSSDMGHGRPGAVPRHHVGVLPRR 492 H+S G G P A+ HHV +P+R Sbjct: 533 HESRPQGSGSPSAIKAHHVLCVPQR 557 >SB_11841| Best HMM Match : Ras (HMM E-Value=0) Length = 523 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 374 GVEFATRSIEVDGKT-IKAQIWDTAGQERYRAITSAYYR 487 GV S GK K I DTAGQE Y A+ Y R Sbjct: 261 GVGHRAHSYSKGGKNKSKTDILDTAGQEEYSAMRDQYMR 299 >SB_10158| Best HMM Match : MMR_HSR1 (HMM E-Value=9.4e-08) Length = 340 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +2 Query: 275 FKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVD--GKTIKAQIWDTAG 448 FKV+++G +GVGKS L++ E+ +E + +T S G+T + +WD+ G Sbjct: 61 FKVIVVGRTGVGKSHLVNTL-MGEYVVEEGQDLDPCTSTVSKHEKRIGRT-RVTVWDSPG 118 >SB_43575| Best HMM Match : Sina (HMM E-Value=0) Length = 432 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 437 DTAGQERYRAITSAYYRGAWA 499 DTAG+E+Y ++S Y RGA A Sbjct: 278 DTAGEEKYAGLSSFYCRGASA 298 >SB_16073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.1 bits (62), Expect = 2.8 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 10/76 (13%) Frame = +2 Query: 266 DYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKS----TIGVEFATRSIEVDGKTI---- 421 DY K++ IG G GK+S + NLE+++ G+ AT ++ +D + Sbjct: 2 DY-HKLLFIGPVGAGKTSAIRALCDEHHNLETEAKASDITGLRKATTTVAMDYGCLTLSD 60 Query: 422 --KAQIWDTAGQERYR 463 Q++ T GQ R+R Sbjct: 61 GEAVQLYGTPGQARFR 76 >SB_15868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 269 YLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVD 409 Y +++LIG GK+SL F+ ST G+E + EVD Sbjct: 289 YRGRIMLIGQDRAGKTSLKKSLFGIPFDPSEVSTEGIEVDPSTFEVD 335 >SB_57342| Best HMM Match : Arf (HMM E-Value=0) Length = 457 Score = 28.7 bits (61), Expect = 3.7 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 413 KTIKAQIWDTAGQERYRAITSAYYRGA 493 K I +WD GQ++ R + Y++GA Sbjct: 152 KNITFSVWDIGGQDKIRRLWRHYFQGA 178 >SB_53088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 269 YLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVD 409 Y +++LIG GK+SL F+ ST G+E + EVD Sbjct: 80 YRGRIMLIGQDRAGKTSLKKSLLGIPFDPGEVSTEGIEVDPSTFEVD 126 >SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRNEFN 352 KVVL+G GK+SL+ R+ + FN Sbjct: 29 KVVLLGKEYSGKTSLVERYLHHRFN 53 >SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) Length = 259 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +2 Query: 371 IGVEFATRSIE-VDGKTIKAQIWDTAGQERYRAITSAYY 484 +G++ A ++E V+ +++K IWD G ++ R + YY Sbjct: 216 LGLDGAGFNVETVEHRSLKFTIWDVGGLQKLRPLWRHYY 254 >SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2) Length = 87 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 272 LFKVVLIGDSGVGKSSLLSRFTRNEF 349 L+KVV G GVGK+SL R +F Sbjct: 27 LYKVVFAGFRGVGKTSLFLRIRDEKF 52 >SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) Length = 322 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 278 KVVLIGDSGVGKSSLLSRFTRN--EFNLESKSTIGVEFATRSIEVDGKTIKAQIWD 439 KV++ GDS VGKS+L+ F + + T+G E + + + T +W+ Sbjct: 7 KVLVTGDSCVGKSALVQVFQSDGTHYPKNYTQTVGAEVLVKLVNIPETT--DSVWE 60 >SB_27378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 413 KTIKAQIWDTAGQERYRAITSAYYRGAWARCWLRHRQAP 529 KT+ Q W QE AI + Y W W RQ P Sbjct: 95 KTLAQQYWRLIRQEPCLAILATYSTRPWPSNWRLIRQEP 133 >SB_7886| Best HMM Match : Cbl_N3 (HMM E-Value=4.9) Length = 667 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 230 RINQNGHKKDEYDYLFKVVLIGDSGVGKSSLLSRFTRN 343 R +N KD KVV+ G++GVGKS F ++ Sbjct: 584 RNQRNADMKDTSADAIKVVVFGEAGVGKSVPSQTFVKS 621 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,776,016 Number of Sequences: 59808 Number of extensions: 314330 Number of successful extensions: 1058 Number of sequences better than 10.0: 95 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -