BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20409 (490 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 28 3.6 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 4.7 SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) 27 8.3 SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) 27 8.3 SB_23806| Best HMM Match : zf-CCHC (HMM E-Value=0.0069) 27 8.3 SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) 27 8.3 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 144 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSIY 257 C ++H G+++ I + R Q+ G+ R C TS++ Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVF 43 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 156 WHWGSVDSISGSRARFQLSGNSGRKHSR 239 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 >SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) Length = 534 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 196 AREPL-MESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAI 71 +REP S PQ H+L +R L + ++ CS CS+ I Sbjct: 57 SREPFDSRSKLPQKHLLNSKRRALAIAKILLACSPEHCSMSFI 99 >SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) Length = 303 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 391 PNKTEKVRSWSDVENG*CLASPHGVGATMAAA 296 P K +K R W D ++G C + +G T+AAA Sbjct: 167 PEKLQKARDWDDWKDGLCGVA---IGYTVAAA 195 >SB_23806| Best HMM Match : zf-CCHC (HMM E-Value=0.0069) Length = 290 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +3 Query: 99 EHGASSCIS-GKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSIYGNLV 269 EH A C + G C HW + + ++ + +GN+ ++ + S Y NLV Sbjct: 139 EHDAQRCPAYGSLCNYCSKPNHWSKICRLKQKYSQIRPTGNANARNQQQHRSQYPNLV 196 >SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) Length = 724 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = -2 Query: 300 QQSTVTQCCRPLNFRICLCS----SGCA 229 ++ST+ QC RPL+ + CL S GCA Sbjct: 363 RKSTIEQCIRPLSLKPCLGSLFETPGCA 390 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,266,462 Number of Sequences: 59808 Number of extensions: 278016 Number of successful extensions: 666 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -