BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20407 (757 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.21 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 4.6 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 22 4.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 73 TLHVLFFI*IYHTSSLHSVFPHTFSLRTPTPTHIIFIHLYYYC 201 T+H+L + IY+ +H +F F + T ++ I+ Y+YC Sbjct: 249 TVHLLLLVCIYYFYYMHLLFCCAFIIFTMHLLFLLCIY-YFYC 290 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 98 RSIIHHHCIQSSLTHSR*GRQLQLTLYSFIYIIIAKKRK 214 R IH+ I S R +++ +L+SF +IA+++K Sbjct: 216 RPWIHNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKK 254 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 424 LFCTLMYSNNNENL*YLTA*CYNIL*ISIDFLV*TDQIVS*IV 552 L L Y+N N +L C N+ ++I F T ++ IV Sbjct: 42 LLTNLTYNNTNRKYYWLNVCCLNLSIVTIFFNFATKKLEQFIV 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,856 Number of Sequences: 336 Number of extensions: 3510 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -