BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20407 (757 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.5 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.8 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 323 EVCLLAGTHVTT*HQQCVHGVNEFALLLKF 412 E+ +AGT + + H +HG + LLKF Sbjct: 268 ELLAVAGTELGSPHMTDIHGATVYNNLLKF 297 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.8 bits (49), Expect = 5.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 121 HSVFPHTFSLRTPTPTHIIFIHLYYYCKK 207 H +FP + ++ T THI+ +L Y K Sbjct: 22 HEIFPTSNAIIWTTVTHILCAYLCYIFSK 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,403 Number of Sequences: 2352 Number of extensions: 14067 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -