BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20407 (757 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032632-9|CAA21588.2| 1464|Caenorhabditis elegans Hypothetical ... 29 3.6 AL023856-5|CAC15865.2| 343|Caenorhabditis elegans Hypothetical ... 29 3.6 Z54237-9|CAA90991.1| 1424|Caenorhabditis elegans Hypothetical pr... 29 4.7 Z54237-8|CAE52902.1| 771|Caenorhabditis elegans Hypothetical pr... 29 4.7 Z54235-11|CAA90978.1| 1424|Caenorhabditis elegans Hypothetical p... 29 4.7 Z54235-10|CAE52905.1| 771|Caenorhabditis elegans Hypothetical p... 29 4.7 AF000196-10|AAC24250.1| 172|Caenorhabditis elegans Hypothetical... 28 6.2 >AL032632-9|CAA21588.2| 1464|Caenorhabditis elegans Hypothetical protein Y11D7A.14 protein. Length = 1464 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +3 Query: 168 SHYIHSFILLLQKNVKLFSVQRTL 239 ++YI SFI+L+Q N++ ++Q+ L Sbjct: 759 NNYISSFIILIQANIRYLNIQKDL 782 >AL023856-5|CAC15865.2| 343|Caenorhabditis elegans Hypothetical protein Y94A7B.8 protein. Length = 343 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 84 PFFYLDLSYIITAFSLPSHI 143 PF Y YII+AFSLP HI Sbjct: 9 PFVYSMCFYIISAFSLPIHI 28 >Z54237-9|CAA90991.1| 1424|Caenorhabditis elegans Hypothetical protein T11B7.4d protein. Length = 1424 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 109 TSSLHSVFPHTFSLRTPTPT 168 T SLH V +SLR PTPT Sbjct: 1134 TQSLHDVLDEFYSLRKPTPT 1153 >Z54237-8|CAE52902.1| 771|Caenorhabditis elegans Hypothetical protein T11B7.4c protein. Length = 771 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 109 TSSLHSVFPHTFSLRTPTPT 168 T SLH V +SLR PTPT Sbjct: 481 TQSLHDVLDEFYSLRKPTPT 500 >Z54235-11|CAA90978.1| 1424|Caenorhabditis elegans Hypothetical protein T11B7.4d protein. Length = 1424 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 109 TSSLHSVFPHTFSLRTPTPT 168 T SLH V +SLR PTPT Sbjct: 1134 TQSLHDVLDEFYSLRKPTPT 1153 >Z54235-10|CAE52905.1| 771|Caenorhabditis elegans Hypothetical protein T11B7.4c protein. Length = 771 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 109 TSSLHSVFPHTFSLRTPTPT 168 T SLH V +SLR PTPT Sbjct: 481 TQSLHDVLDEFYSLRKPTPT 500 >AF000196-10|AAC24250.1| 172|Caenorhabditis elegans Hypothetical protein B0041.1 protein. Length = 172 Score = 28.3 bits (60), Expect = 6.2 Identities = 22/59 (37%), Positives = 31/59 (52%) Frame = +3 Query: 69 FDAACPFFYLDLSYIITAFSLPSHILVKDANSNSHYIHSFILLLQKNVKLFSVQRTLGL 245 F+ AC +F L + II SL S L NS +I S + + +KN+ +FS LGL Sbjct: 109 FEIAC-YFILHWASIIFNQSLSSIKLSYHFGMNS-FIDSLLSIFKKNLNIFSKIGGLGL 165 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,780,637 Number of Sequences: 27780 Number of extensions: 311829 Number of successful extensions: 563 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -