BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20407 (757 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 7.1 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 21 9.4 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 172 IIFIHLYYYCKKT*NSSRYRGLL 240 ++F+ LYYY T + + RG++ Sbjct: 13 VLFLALYYYLTSTFDFWKSRGVV 35 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 64 VGSTLHVLFFI*IYHTSSLHSVFPHTFSLRTPTPTHII 177 +G + +L F+ + + +F T SLRTP+ +I Sbjct: 21 LGFVIGMLGFVSVMGNGMVVYIFLSTKSLRTPSNLFVI 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,808 Number of Sequences: 438 Number of extensions: 4345 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -