BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20406 (581 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB7E8.01 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 29 0.37 SPBC725.05c |||nucleotide pyrophosphatase |Schizosaccharomyces p... 25 6.1 SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|... 25 8.1 >SPBPB7E8.01 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 569 Score = 29.5 bits (63), Expect = 0.37 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 43 LTLIPICGFDAACPFFYLDLSYI-ITAFSLPSHILVKDANSNSHYI 177 L + P G D PF YLD SY+ ++ S SH+ + + +++ Sbjct: 368 LVIYPDAGIDTYSPFIYLDSSYVPFSSGSSLSHVALHHYDCEPNFL 413 >SPBC725.05c |||nucleotide pyrophosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 485 Score = 25.4 bits (53), Expect = 6.1 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -3 Query: 78 CSVEPTYWDKGK 43 C+ +PT+WDKG+ Sbjct: 157 CNKDPTWWDKGE 168 >SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 25.0 bits (52), Expect = 8.1 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 28 KKYLFLTLIPICGFDAACPFFYLD--LSYIITAFSLPS 135 + Y+FL L+P+ AAC D L+ + T+ SL S Sbjct: 229 RTYMFLELLPLQSITAACESILKDYLLNLVKTSESLSS 266 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,266,476 Number of Sequences: 5004 Number of extensions: 44650 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -