BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20406 (581 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0148 - 5928703-5928931,5929099-5929171,5929288-5929408,592... 29 2.7 02_02_0331 + 9017291-9019084,9019205-9019402,9020014-9020184,902... 29 3.6 >03_02_0148 - 5928703-5928931,5929099-5929171,5929288-5929408, 5929907-5929952,5930361-5930571,5930837-5930986, 5931122-5931179,5931285-5931400,5931986-5932091 Length = 369 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +3 Query: 168 TLYSFIYII--IAKKRKTLLGTEDSWPLTA 251 TL SFIY+ + K+R + GT+ SW LTA Sbjct: 146 TLGSFIYVPCEVMKQRMQVQGTKKSWALTA 175 >02_02_0331 + 9017291-9019084,9019205-9019402,9020014-9020184, 9020292-9020435,9020552-9020764,9020859-9021929, 9022365-9022391 Length = 1205 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 101 YHTSSLHSVFPHTFSLRTPTPTHIIFIHLYYY 196 +H+ H+ P +S R P+P I HLYY+ Sbjct: 24 FHSCCNHTYPPGYYSFRLPSPQEIPPPHLYYH 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,228,971 Number of Sequences: 37544 Number of extensions: 239789 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -