BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20400 (514 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59140.1 68416.m06593 ABC transporter family protein putative... 27 5.6 At5g58820.1 68418.m07370 subtilase family protein contains simil... 27 9.8 >At3g59140.1 68416.m06593 ABC transporter family protein putative multi resistance protein mrp - Arabidopsis thaliana, EMBL:ATMRPPROT Length = 1453 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 59 CLTTEKICVVFVYSESSGILFKNVKQTSLRVLVSVY 166 CL +CVV + +SS LF + + R +S Y Sbjct: 942 CLMVRSVCVVIMCMKSSASLFSQLLNSLFRAPMSFY 977 >At5g58820.1 68418.m07370 subtilase family protein contains similarity to prepro-cucumisin GI:807698 from [Cucumis melo] Length = 703 Score = 26.6 bits (56), Expect = 9.8 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -2 Query: 174 ISL*TDTRTRNEVCLTFLKSIPELSEYTKTTHIFSVVR 61 +S D +V + ++ S+P L EYT +H S+++ Sbjct: 17 VSAVIDDPQNKQVYVVYMGSLPSLLEYTPLSHHMSILQ 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,735,055 Number of Sequences: 28952 Number of extensions: 248400 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -