BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20397 (800 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q29AL2 Cluster: GA19502-PA; n=1; Drosophila pseudoobscu... 34 4.8 >UniRef50_Q29AL2 Cluster: GA19502-PA; n=1; Drosophila pseudoobscura|Rep: GA19502-PA - Drosophila pseudoobscura (Fruit fly) Length = 4926 Score = 33.9 bits (74), Expect = 4.8 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +3 Query: 114 RACICYCKLQTCVHKCSRLIEMLMEIVNNLKT 209 R CI Y + T HKCS+LI ML E V NL T Sbjct: 1413 RNCIIYSERSTA-HKCSKLIIMLTEGVTNLPT 1443 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,483,830 Number of Sequences: 1657284 Number of extensions: 12738499 Number of successful extensions: 26764 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 25585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26756 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68731504465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -