BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20397 (800 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.2 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 6.5 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 6.5 AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 21 8.7 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.7 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.7 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 237 CCVNKVAYGKFSNYLLSPLTFLSNVSTYEHT 145 C +N + Y L+ L F ++STYE++ Sbjct: 377 CDINSIQYFCLMARCLNTLIFYYHISTYEYS 407 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 569 KDILLINPKIRFYN 528 KDI+ INP +++ N Sbjct: 10 KDIVFINPLVKYLN 23 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +3 Query: 693 KNSICLKCL*HICDASINSLNKTYI 767 KN +CL L +CD + K+ + Sbjct: 262 KNFVCLLSLIILCDCVVKEAQKSLV 286 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 153 EHTFVVYNNKYMLFFSSMNFRIN 85 EH F+V + Y L+F + + ++ Sbjct: 51 EHLFIVTHQAYELWFKQIIYELD 73 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 153 EHTFVVYNNKYMLFFSSMNFRIN 85 EH F+V + Y L+F + + ++ Sbjct: 51 EHLFIVTHQAYELWFKQIIYELD 73 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 153 EHTFVVYNNKYMLFFSSMNFRIN 85 EH F+V + Y L+F + + ++ Sbjct: 51 EHLFIVTHQAYELWFKQIIYELD 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,060 Number of Sequences: 336 Number of extensions: 3880 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -