BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20397 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +3 Query: 369 DLISQV--GWRQLRCRCLWAPVTT*HRWAVSS-STHLCNKMKQV 491 D +SQ G +L C CL PV +R + +TH CNK K++ Sbjct: 1938 DCVSQPVEGIARLGCSCLSFPVARIYRRTPNKYATHTCNKYKRI 1981 >SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1167 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = -2 Query: 787 ILKIRKLIYVLFKEFMEASHICYKHFKHIEFFCLS*D*ANLNCALLYAMRQYENHFGINT 608 + ++ +I++L K E +C FK FF L+ D + Y+ Q+E +NT Sbjct: 459 VASVKSIIHLL-KAIKEKPDVCEPVFKIGNFFELTADEFPDELEISYSHLQFEKDLEVNT 517 Query: 607 Y 605 Y Sbjct: 518 Y 518 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,845,232 Number of Sequences: 59808 Number of extensions: 416757 Number of successful extensions: 655 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -