Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20397
         (800 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82060-2|CAB04882.1|  421|Caenorhabditis elegans Hypothetical pr...    28   6.8  

>Z82060-2|CAB04882.1|  421|Caenorhabditis elegans Hypothetical
           protein T27F6.2 protein.
          Length = 421

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = -3

Query: 528 LLQAVVYL-NDITTLVSFYCIDGWTNSQPTCVKWLPEPIDIYNVIAATQLEI*DLSIVTM 352
           LL   +YL N +T+  S +C DG+T     C+K  P  +   + +A +       ++VT+
Sbjct: 7   LLFLSIYLENFLTSSRSIHCTDGFTLINSKCLKLFPSLVS--HTVAESSCNSYGATLVTV 64

Query: 351 FNMNVSSDVISV 316
            N+     + ++
Sbjct: 65  KNVKDDEAIAAI 76


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,719,712
Number of Sequences: 27780
Number of extensions: 325841
Number of successful extensions: 711
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 689
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 711
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1956310428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)