BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20393 (583 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28012| Best HMM Match : RNA_pol_Rpa43 (HMM E-Value=7.1e-08) 59 2e-09 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 28 4.8 >SB_28012| Best HMM Match : RNA_pol_Rpa43 (HMM E-Value=7.1e-08) Length = 242 Score = 59.3 bits (137), Expect = 2e-09 Identities = 29/79 (36%), Positives = 42/79 (53%) Frame = +2 Query: 242 RVERFLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLS 421 ++ +V+Y +LQ G I +++ +HF Q DY F+P IG KL G+VNK H+ Sbjct: 62 KLRAVIVAYDKVTLLQRRGNIIDESPFLHFDAQVDYITFKPEIGNKLIGVVNKFGYDHIG 121 Query: 422 VLVHRVFNVVIPQPTEEPG 478 LVH FN I + G Sbjct: 122 CLVHGCFNASIAKSRTSNG 140 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 373 TYVWLKYEVIRLNLEMYIRIIIAYSANILKYTR 275 TYV EVI N MYI +A + ++L+Y R Sbjct: 110 TYVTTLLEVIETNTRMYIITDLAENGDLLEYIR 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,866,934 Number of Sequences: 59808 Number of extensions: 295529 Number of successful extensions: 529 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -