BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20393 (583 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-1185|AAF52451.1| 253|Drosophila melanogaster CG13773-P... 51 1e-06 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 29 4.6 >AE014134-1185|AAF52451.1| 253|Drosophila melanogaster CG13773-PA protein. Length = 253 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/70 (31%), Positives = 41/70 (58%) Frame = +2 Query: 245 VERFLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSV 424 ++ ++ KN +L +R D+ +H + AD+++F+P GA L+G+V H+S Sbjct: 66 LDGIVLGIKNIKVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISRHHVSA 125 Query: 425 LVHRVFNVVI 454 +++RVFN I Sbjct: 126 VIYRVFNTSI 135 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 63 IMSKIIKFDLRELKQLANDKNSCLVVKKITQNLALQPWCLGNIKESITNLL-DYKVGKFD 239 I+ K IKF ++EL+ A+ SC+ +LA+ P+ + N K ++ LL KVG +D Sbjct: 4 ILQKYIKFSVKELENYASSPESCVRCITTDMHLAMGPYGMANFKHALHELLIRTKVGFYD 63 Query: 240 KELNG 254 L+G Sbjct: 64 SGLDG 68 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +2 Query: 266 YKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSVL 427 Y+NPC V R + A Q +Y+ PY G + ++N CS+HL+ L Sbjct: 17964 YQNPCGSNAVCRERGEAASC--QCLPEYY-GNPYEGCRPECVLNSDCSSHLACL 18014 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,709,277 Number of Sequences: 53049 Number of extensions: 417278 Number of successful extensions: 708 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2317436688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -