BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20391 (529 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 2.2 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 6.7 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +3 Query: 27 SSFFYEHLLKYSIRSKLSVQQCIFKIL*NTGCTQII 134 S+F +HL K+S + +++ + T CT +I Sbjct: 310 SNFVSQHLPKFSAANFFDIERSTILSVLGTACTFLI 345 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.0 bits (42), Expect = 6.7 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 157 HFQSQPFCYLYVIAHRQKG 213 H Q QPF Y + ++ G Sbjct: 476 HLQHQPFTYKITVNNQSNG 494 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,494 Number of Sequences: 336 Number of extensions: 2523 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -