BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20391 (529 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51990| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 29 3.1 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_69| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_51990| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1055 Score = 28.7 bits (61), Expect = 3.1 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 9/77 (11%) Frame = -2 Query: 348 YFIKVL--STFFYILC--CIFSFN-ITLLYS-FLFCIRLF---ARN*CLS*ACHSFLSVC 196 +F VL + F+ +C C FN ++L++S F+ C +L ARN + L C Sbjct: 682 FFTDVLLSNIVFFTICVLCFLLFNPVSLIFSNFMDCSQLADNNARNFFSYIVAVALLHFC 741 Query: 195 NNIQITKWLALKMQLFF 145 N Q+T W+ + F Sbjct: 742 NFTQLTSWMKTSLAAVF 758 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -2 Query: 369 YHKNLLIYFIKVLSTFFYILC-CIFSFNITLLYSFLFCIRLFARN*CLS*AC 217 Y + I+ + V F Y+ CIF+ +++L Y +L I +FA + L C Sbjct: 1951 YLCGIRIFALSVSLRFLYLCAFCIFALSVSLRYLYLCAICIFALSVSLRYIC 2002 >SB_69| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 351 LKDSYGNN*MFYIFIFHKCAMLHEGR 428 L++S N F + FHKC++LH R Sbjct: 582 LENSKNENVSFCVVEFHKCSILHNER 607 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,942,519 Number of Sequences: 59808 Number of extensions: 254896 Number of successful extensions: 446 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -