BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20391 (529 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12860.1 68414.m01494 basic helix-loop-helix (bHLH) family pr... 27 7.8 >At1g12860.1 68414.m01494 basic helix-loop-helix (bHLH) family protein / F-box family protein contains Pfam profiles: PF00646 F-box domain, PF00010 helix-loop-helix DNA-binding domain Length = 828 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 370 ITKCFIFSYFINVQCYMKAGKGFRFFPESL 459 +TKC +F + N Y+ +R FP+ + Sbjct: 263 VTKCEVFDFRANAWRYLTCTPSYRIFPDQV 292 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,684,298 Number of Sequences: 28952 Number of extensions: 174181 Number of successful extensions: 293 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 293 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -