BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20389 (784 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.6 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 6.1 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.0 bits (52), Expect = 2.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 569 EAAIQREVSSPSRARPLTPRLVCKYIACNIPTRKSLFIIVSR 694 EA + R + P R + L L + I C +P KSL VSR Sbjct: 364 EALLPR-LPLPGRIKALIGNLFAQTIRCCVPDLKSLREFVSR 404 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 596 SPSRARPLTPRLVCKYIA 649 +PS + PLTP +C IA Sbjct: 459 TPSSSPPLTPNTICGLIA 476 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,569 Number of Sequences: 2352 Number of extensions: 13497 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -