BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20388 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 26 0.99 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 26 0.99 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 26 1.3 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 25 3.0 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 24 4.0 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 24 5.3 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 24 5.3 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 23 7.0 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.2 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 23 9.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.2 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 9.2 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 26.2 bits (55), Expect = 0.99 Identities = 10/42 (23%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 302 KRPLVDLRNPGPPQHQEHET--QNPEHHEDAEKIVSSVKNDI 421 KR + L++ P ++ T P+HH++ ++ +KN + Sbjct: 1603 KRDRIILQDESEPNTSQYSTFIHEPKHHQEDPPVLKYIKNQV 1644 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 26.2 bits (55), Expect = 0.99 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 427 CVNVIFDGRNDFFSIFVVFRILCFVLLMLRGP 332 C +F+G++ IF+V ++C L+L P Sbjct: 619 CKEFMFEGQDTLQVIFIVLGLICIPWLLLAKP 650 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 427 CVNVIFDGRNDFFSIFVVFRILCFVLLMLRGP 332 C +F+G+N+ FV +LC ++L P Sbjct: 630 CDEFMFEGQNELQRTFVFIALLCIPWMLLGKP 661 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.6 bits (51), Expect = 3.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 60 QPAIPDKVPEAEDKPLNVVDNLSSEQELI 146 +P P P A +PL +VDNL+ QE++ Sbjct: 520 KPGKPPGHPSAF-RPLGLVDNLAKVQEMV 547 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 24.2 bits (50), Expect = 4.0 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Frame = +3 Query: 96 DKPLNVVDNLSSEQELIDQANTIKDIDN------SLRANKKEVIDIPV 221 D+P +D + E+E+I+++N D DN S +N K+++D V Sbjct: 88 DEPKTSLDPVVVEEEIIEESNG-PDGDNLVLEQGSNNSNSKDIVDFEV 134 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.8 bits (49), Expect = 5.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 260 DLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHE 382 D +V VP IK+ + P P Q H Q+P HH+ Sbjct: 63 DEMSVVVPISPLHIKQEPLGSDGPMPAQPPHHH-QHPHHHQ 102 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.8 bits (49), Expect = 5.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 260 DLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHE 382 D +V VP IK+ + P P Q H Q+P HH+ Sbjct: 63 DEMSVVVPISPLHIKQEPLGSDGPMPAQPPHHH-QHPHHHQ 102 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 302 KRPLVDLRNPGPP--QHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 436 +RP+ D + PGP Q + + Q P + V ++ + N I Sbjct: 47 RRPVADDQQPGPSGLQRLQQQQQQPSRLTPVREAVENIPSPRNGPNI 93 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 323 RNPGPPQHQEHETQNPEHHEDAEKIVS 403 ++PG QH H + HH + S Sbjct: 176 QHPGHSQHHHHHHHHHPHHSQQQHSAS 202 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 632 CVSSTEGAAMVSAGLIKCSVSFNFCI 555 C+ T G +V GL+ SF F + Sbjct: 231 CIGDTFGLMLVKVGLVAMVRSFRFTL 256 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 341 QHQEHETQNPEHHEDAEKIVSS 406 QHQ+H+ +HH + SS Sbjct: 1321 QHQQHQQHQLQHHHQPQLSQSS 1342 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 293 EEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE 391 E ++RP D R P +E T+ H DAE Sbjct: 212 ELLQRPAADSRRQEGPSTRESGTRWRTRHFDAE 244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,333 Number of Sequences: 2352 Number of extensions: 11875 Number of successful extensions: 81 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -