BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20372 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52425| Best HMM Match : Arm (HMM E-Value=9.7e-28) 66 2e-11 SB_20122| Best HMM Match : Arm (HMM E-Value=1.2e-24) 61 1e-09 SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29650| Best HMM Match : Arm (HMM E-Value=7.30076e-43) 52 3e-07 SB_35833| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_22229| Best HMM Match : Arm (HMM E-Value=0) 36 0.024 SB_53106| Best HMM Match : PLAT (HMM E-Value=0) 36 0.032 SB_19563| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_3360| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_47670| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 29 2.7 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 2.7 SB_11650| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_22495| Best HMM Match : DUF116 (HMM E-Value=8.1) 29 4.8 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_38184| Best HMM Match : HisKA_2 (HMM E-Value=8.6) 29 4.8 SB_45305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_47985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_46871| Best HMM Match : PAN (HMM E-Value=1) 28 6.3 SB_27445| Best HMM Match : DUF227 (HMM E-Value=9.9) 28 6.3 SB_48321| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_19076| Best HMM Match : HECT (HMM E-Value=0) 28 8.4 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_52425| Best HMM Match : Arm (HMM E-Value=9.7e-28) Length = 234 Score = 66.5 bits (155), Expect = 2e-11 Identities = 39/72 (54%), Positives = 45/72 (62%) Frame = +1 Query: 481 VGCCATMQKMLSCDKNPPIDELIAAGILPILVQCLSRADNPALQFETAWALTNIASGTSA 660 +G +K+LS DKNPPID+LI N +LQFE AWALTNIASGTS Sbjct: 46 LGAVQAARKLLSKDKNPPIDDLI----------------NHSLQFEAAWALTNIASGTSE 89 Query: 661 QTNKVVHAGAVP 696 QT VV+AGAVP Sbjct: 90 QTQAVVNAGAVP 101 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = +2 Query: 338 KREETLQKRRNVPISYSTDEEEIDKNLATTDLDELVMNAANAENPEAQLAAVQQCRK 508 KRE+ +QKRRNVP+ +E D+ DL+ +VM A +++P QL AVQ RK Sbjct: 2 KREDCMQKRRNVPLEL---PDEKDEKFQRRDLNAIVME-AGSDDPSVQLGAVQAARK 54 >SB_20122| Best HMM Match : Arm (HMM E-Value=1.2e-24) Length = 163 Score = 60.9 bits (141), Expect = 1e-09 Identities = 35/68 (51%), Positives = 43/68 (63%) Frame = +1 Query: 496 TMQKMLSCDKNPPIDELIAAGILPILVQCLSRADNPALQFETAWALTNIASGTSAQTNKV 675 +++KMLS +K+PPID++I NP LQFE AWALTNIASGTS QT V Sbjct: 16 SVRKMLSKEKSPPIDDVI----------------NPLLQFEAAWALTNIASGTSEQTKAV 59 Query: 676 VHAGAVPV 699 GAVP+ Sbjct: 60 QEGGAVPM 67 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 556 GILPILVQCLSRA-DNPALQFETAWALTNIASGTSAQTNKVVHAGAV 693 G +P+ V+ LS DN A Q WAL NIA N V+ GA+ Sbjct: 63 GAVPMFVKLLSSVHDNVAEQ--AVWALGNIAGDGPLMRNTVIACGAL 107 >SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 60.5 bits (140), Expect = 1e-09 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 6/91 (6%) Frame = +2 Query: 254 LHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTD- 430 + +KN DV EMRRRR E V+LRK KREE + KRRNV ++ ++ + L T+D Sbjct: 690 IKAYKNKSLDVSEMRRRREEEGVQLRKAKREEQMFKRRNVEVTRTSSTGSELEELLTSDY 749 Query: 431 -----LDELVMNAANAENPEAQLAAVQQCRK 508 L + ++ A +++ E QLAA Q+ RK Sbjct: 750 MAEGPLFQDMVQAIISDDVEMQLAATQRFRK 780 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = +1 Query: 502 QKMLSCDKNPPIDELIAAGILPILVQCLSRADNPALQ 612 +K+LS + NPPID++I G++P V+ L R DN ALQ Sbjct: 779 RKILSKEPNPPIDDVIKCGVIPKFVEFLQREDNSALQ 815 >SB_29650| Best HMM Match : Arm (HMM E-Value=7.30076e-43) Length = 215 Score = 52.4 bits (120), Expect = 3e-07 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +1 Query: 598 NPALQFETAWALTNIASGTSAQTNKVVHAGAVPV 699 +P LQFE AWALTNIASGTS QT V GAVP+ Sbjct: 18 HPLLQFEAAWALTNIASGTSEQTKAVQEGGAVPM 51 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +1 Query: 520 DKNPPIDELIAAGILPILVQCLSRADNPALQFETAWALTNIASGTSAQTNKVVHAGAVP 696 +KNPP D +LP + + + D L +T WAL+ + G + + V+ +G VP Sbjct: 120 NKNPPPDVTAVQQVLPAIARLILSDDKEVLA-DTCWALSYLTDGVNERIQLVLDSGVVP 177 Score = 32.7 bits (71), Expect = 0.29 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 526 NPPIDELIAAGILPILVQCLSRADNPALQFETAWALTNIASGTSAQ 663 N I ++ +G++P LV+ L + L E AWA++N+ +GT+ Q Sbjct: 164 NERIQLVLDSGVVPKLVELLGYPEVNVL--EAAWAISNVTAGTAQQ 207 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 556 GILPILVQCLSRA-DNPALQFETAWALTNIASGTSAQTNKVVHAGAV 693 G +P+ V+ LS DN A Q WAL NIA N V+ GA+ Sbjct: 47 GAVPMFVKLLSSVHDNVAEQ--AVWALGNIAGDGPLMRNTVIACGAL 91 >SB_35833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +1 Query: 595 DNPALQFETAWALTNIASGTSAQTNKVVHAGAVPV 699 D +LQFE AWALTNIASGTS QT VV+AG PV Sbjct: 760 DGHSLQFEAAWALTNIASGTSEQTQAVVNAGDGPV 794 >SB_22229| Best HMM Match : Arm (HMM E-Value=0) Length = 1050 Score = 36.3 bits (80), Expect = 0.024 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +1 Query: 544 LIAAGILPILVQCLSRADNPALQFETAWALTNIASGTSAQTNKVVHAGAVPV 699 ++ G L LV CL D P ++ AWAL IA + + VV AGAVP+ Sbjct: 119 VVDCGALDALVICLEEFD-PGVKEAAAWALGYIARHNAELSQAVVDAGAVPL 169 >SB_53106| Best HMM Match : PLAT (HMM E-Value=0) Length = 1790 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 556 GILPILVQCLSRADNPALQFETAWALTNIASGTSAQTNKV 675 G +PI+V+CLS N ++F A L N++SGT + NK+ Sbjct: 1216 GGIPIVVRCLSH-QNDQVRFAAACVLRNLSSGTKSDQNKL 1254 >SB_19563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +1 Query: 559 ILPILVQCLSRADNPALQFETAWALTNIASGTSAQTNKVVHAGAVPV 699 +L ++ CL ++ + ++ E+ W L+N+ +G + VVHAG VPV Sbjct: 20 LLHAVMACL-QSSHRHVRKESLWVLSNLTAGPAESCWAVVHAGLVPV 65 >SB_3360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 598 NPALQFETAWALTNIASGTSAQTNKVVHAGA 690 N LQ E AW +TN+++GT T +V+ A A Sbjct: 112 NIDLQLEAAWCITNLSAGTHEDTLRVLKAAA 142 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 260 VFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEE 403 ++K G V R RR +LRK +RE L +R I ++ +E E Sbjct: 6 LYKQGGHSVQAQRSRRRGQEADLRKERRERLLSSKR---IRFAEEEAE 50 >SB_47670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +2 Query: 245 EKPLHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEE 403 + P V+K A + R+R+E T E++K + +KRR + S +EEE Sbjct: 118 DMPKAVYKLAVLSAGKKIRKRHEKTTEMQKQTKMVPRKKRRVLSSSEEEEEEE 170 >SB_17370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1743 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 430 VGGSEVLVDLLLIGRIANGHITPFLKCFLSFVFS*LDCDFIPSPAHFIDIFACILE 263 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 1488 IGGTSVSLDHRMIGRITRKFFVDFL-CFRNTAILRSSCKLQYLPIHVSGFSRCLFE 1542 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/87 (25%), Positives = 40/87 (45%) Frame = +2 Query: 266 KNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTDLDELV 445 + A K +E R+R E +K K+EE L++++ + +E+E + L + + Sbjct: 260 EEAEKKREEEERKRREEEEAAQKWKKEELLRQQQ---LEREKEEQERAERLQREREEAME 316 Query: 446 MNAANAENPEAQLAAVQQCRKCSRVIK 526 E EA+ AA + RK + K Sbjct: 317 AEDLAEEAAEAEAAAAEAARKAAEEAK 343 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 291 SSTSLPAFLNTCSGFSLDQSPFYLCSL 211 ++T LP + C+GFS D PF C + Sbjct: 403 TTTELPTTPDPCAGFSCDSPPFSTCKV 429 >SB_11650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 29.1 bits (62), Expect = 3.6 Identities = 26/111 (23%), Positives = 47/111 (42%) Frame = +2 Query: 239 SSEKPLHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNL 418 S ++ L++ N G+D R R + KNK + + I++S D+ D+ Sbjct: 84 SGKEHLNMATN-GRDRTGDRYHRTRSAINDSKNKIQPNNTSTNSTRITWSMDDPATDEVF 142 Query: 419 ATTDLDELVMNAANAENPEAQLAAVQQCRKCSRVIKTRLLMSS*LLEYSPS 571 D+DEL +A + L + + CS ++ L + + SPS Sbjct: 143 RELDVDELRWPEEDARDSSQDLK--NKTKVCSPLLDENLGILPGVAPLSPS 191 >SB_22495| Best HMM Match : DUF116 (HMM E-Value=8.1) Length = 440 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 430 VGGSEVLVDLLLIGRIANGHITPFLKCFLSFVFS*LDCDFIPSPAHFIDIFACILE 263 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 341 IGGTSVSLDHRMIGRITRKLFVDFL-CFRNTAILRSSCKLQYLPIHVSGFSRCLFE 395 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 28.7 bits (61), Expect = 4.8 Identities = 24/86 (27%), Positives = 43/86 (50%) Frame = +2 Query: 278 KDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTDLDELVMNAA 457 KD DEMRR ++T +LR+ + L + + S + +K T +DEL + A Sbjct: 1545 KDADEMRRNIIKLTTQLREADKAR-LNQGEIDDLKLSLSISQAEKQQLQTRIDEL--DRA 1601 Query: 458 NAENPEAQLAAVQQCRKCSRVIKTRL 535 +A+ E VQ+ +K + +K ++ Sbjct: 1602 HADLRET-AEEVQRIKKENASLKAQV 1626 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.7 bits (61), Expect = 4.8 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = +2 Query: 239 SSEKPLHVFKNAGKDVD-----EMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEE 403 SS+K ++ GKDVD E+RR+R E + +REE + RR + +EEE Sbjct: 450 SSDK--ETVRSDGKDVDDSGSLELRRQREEARRLEEQRRREEEERTRREKEEAQRREEEE 507 >SB_38184| Best HMM Match : HisKA_2 (HMM E-Value=8.6) Length = 528 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 430 VGGSEVLVDLLLIGRIANGHITPFLKCFLSFVFS*LDCDFIPSPAHFIDIFACILE 263 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 394 IGGTSVSLDHRMIGRITRKLFVDFL-CFRNTAILRSSCKLQYLPIHVSGFSRCLFE 448 >SB_45305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/65 (21%), Positives = 30/65 (46%) Frame = +2 Query: 257 HVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTDLD 436 H A + +DE R+R+++ V ++ + EE L+ N ++ + E + + + Sbjct: 238 HDKSQANRSIDEDRKRKSDELVSVKGDSEEEGLENVENTDVNGNEGPEAKKRKVIYQENS 297 Query: 437 ELVMN 451 L N Sbjct: 298 GLAQN 302 >SB_47985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1681 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -3 Query: 191 NYTKKQRINIKLLSSKLIKHVLRHYTSDGGLTSIFTKYSTTHK 63 NY ++ + ++ L+S+ + + H D LTS Y+ HK Sbjct: 128 NYAREHKRDVTSLTSQTLHYAREHKRDDTSLTSQTLHYAREHK 170 >SB_46871| Best HMM Match : PAN (HMM E-Value=1) Length = 525 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 314 VTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTD 430 V ++ R N QK+ N+P S D E ID++L D Sbjct: 380 VRLDSRTNSSSSKRQKKTNLPKSGENDVEIIDRSLVRDD 418 >SB_27445| Best HMM Match : DUF227 (HMM E-Value=9.9) Length = 129 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 430 VGGSEVLVDLLLIGRIANGHITPFLKCFLSFVFS*LDCDFIPSPAHFIDIFACILE 263 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 5 IGGTSVSLDHRMIGRITRKLFVDFL-CFCNTAILRSSCKLQYLPIHVSVFSRCLFE 59 >SB_48321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +2 Query: 311 EVTVELRKNKR-EETLQKRRNVPISYSTDEEEIDKNLATTDLDELVMNAANAENPEAQLA 487 E++ L + R +ET N P+S +E + + T DE++ + E A ++ Sbjct: 183 EISESLLSSLRPKETFHGSENRPLSIKRQRKEAETSTVQTTADEVLKALKSVETHTANVS 242 Query: 488 AVQQCRKCSRVIKTRLL 538 +Q S++ LL Sbjct: 243 MPEQPASFSQISDPHLL 259 >SB_19076| Best HMM Match : HECT (HMM E-Value=0) Length = 2018 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +1 Query: 412 EPRYHRP**AGDERCQRRKP*STVGCCATMQKMLSCDKNPP 534 E R H P A D R + + T+G CAT + D +PP Sbjct: 632 EQRQHHPHRANDTRPKTKS--KTIGTCATTNPLPDHDLDPP 670 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 359 KRRNVPISYSTDEEEIDKNLATTDLDELVMNAANAENPEAQLAAVQQCR 505 K N+P + +T +EE L T D E +N N+ + + L A+Q + Sbjct: 19 KENNLPRTLATLQEETGITLNTVDSVESFVNEINSGHWDTVLTAIQSLK 67 >SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +2 Query: 266 KNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEI--DKNLATTDLDE 439 K K +E R E ++RK K+E+ +KR+ V +++ EEE+ K A++ D+ Sbjct: 138 KTNNKSDNEEEDERQEK--KIRKQKQEK--RKRKTVKADFNSSEEEVSSQKTKASSRKDQ 193 Query: 440 LVMN 451 MN Sbjct: 194 KKMN 197 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/72 (25%), Positives = 32/72 (44%) Frame = +2 Query: 266 KNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTDLDELV 445 K + DE+ R++ E E ++ + EE+ +K DEEE ++ D+ Sbjct: 1038 KKMKDEQDEIERKKAE-EEEKKRKEEEESKKKDEKEKEEEDEDEEEEEEKKEDAKTDDSE 1096 Query: 446 MNAANAENPEAQ 481 A E+ EA+ Sbjct: 1097 TKEAEPESKEAE 1108 >SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 266 KNAGKDVDEMRRRRNEVTVELRKNKREETLQKRR 367 K+ +D DE++R+R V +R+ +R+ QKRR Sbjct: 205 KDEKEDEDELKRKR--TGVRIRRRRRQRRKQKRR 236 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,269,579 Number of Sequences: 59808 Number of extensions: 478520 Number of successful extensions: 1466 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -