BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20369 (779 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) 63 3e-10 SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) 36 0.028 SB_33049| Best HMM Match : 3_5_exonuc (HMM E-Value=0) 33 0.20 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 31 0.79 SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) 31 0.79 SB_10698| Best HMM Match : bZIP_1 (HMM E-Value=0.01) 25 1.7 SB_33106| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16625| Best HMM Match : Death (HMM E-Value=1.5) 30 1.8 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 30 1.8 SB_26423| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) 30 2.4 SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) 30 2.4 SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_13912| Best HMM Match : rRNA_methylase (HMM E-Value=2.6) 29 3.2 SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_35592| Best HMM Match : zf-CCHC (HMM E-Value=0.0087) 29 3.2 SB_34021| Best HMM Match : Zip (HMM E-Value=0) 29 3.2 SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_36636| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_7539| Best HMM Match : Sulfatase (HMM E-Value=3.5e-05) 29 5.6 SB_20040| Best HMM Match : DUF293 (HMM E-Value=2.9) 29 5.6 SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0) 29 5.6 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 28 7.4 SB_16870| Best HMM Match : Methyltransf_3 (HMM E-Value=1) 28 7.4 SB_5478| Best HMM Match : NDT80_PhoG (HMM E-Value=3.6e-21) 28 7.4 SB_52306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_36993| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_7966| Best HMM Match : DNA_ligase_A_C (HMM E-Value=4.8) 28 9.8 SB_53576| Best HMM Match : SCAN (HMM E-Value=2.3) 28 9.8 SB_15442| Best HMM Match : rve (HMM E-Value=0.00084) 28 9.8 >SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) Length = 750 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/67 (47%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = +3 Query: 231 PEVF--IRRYEKFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKHTT 404 PEV + FD+S+LKH E QEKNPLP KD + E V+ FD +++KH Sbjct: 674 PEVLPDVSAVASFDASKLKHVEVQEKNPLPTKDDITTESTETRA--EVKTFDHSKLKHVQ 731 Query: 405 TEEKNPL 425 TEEKNPL Sbjct: 732 TEEKNPL 738 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Frame = +3 Query: 231 PEVFIRRYE--KFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKHTT 404 PEV R E KFD+S+LKH ET+EK +P KDV+ AE V+ FD +++KH Sbjct: 522 PEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAEAIDSRA--EVKSFDHSKLKHVV 579 Query: 405 TEEKNPL 425 T+EKNPL Sbjct: 580 TQEKNPL 586 Score = 60.9 bits (141), Expect = 1e-09 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Frame = +3 Query: 231 PEVFIRRYE--KFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKHTT 404 P+ F R E F+ S+L+H ET+EKN LP KD +A EK GVE F K ++KH Sbjct: 445 PDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDTIADEK-RTAPFSGVEVFQKNKLKHVE 503 Query: 405 TEEKNPL 425 T EKNPL Sbjct: 504 TLEKNPL 510 Score = 55.6 bits (128), Expect = 4e-08 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +3 Query: 255 EKFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNLLD--GVEHFDKTQMKHTTTEEKNPL 425 + FD S+LKH ET EKNPLP V+ E + L D V FD +++KH +EKNPL Sbjct: 644 KSFDHSKLKHVETVEKNPLPSAAVLKEEMRPEVLPDVSAVASFDASKLKHVEVQEKNPL 702 Score = 54.4 bits (125), Expect = 1e-07 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 2/112 (1%) Frame = +3 Query: 255 EKFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNLLD--GVEHFDKTQMKHTTTEEKNPLX 428 + FD S+LKH TQEKNPLP + E +N D V FD T++KH TT+EK+ + Sbjct: 568 KSFDHSKLKHVVTQEKNPLPTPQTLHEELIPKNKPDRSEVASFDHTKLKHVTTQEKSIMP 627 Query: 429 XXXXXXXXXXXNKFLNGIENFDPTKLNTRKRARRTRSPQRTSLSKRNQLEPL 584 ++ +++FD +KL + + P L + + E L Sbjct: 628 SQEDIKEEAVDSR--AEVKSFDHSKLKHVETVEKNPLPSAAVLKEEMRPEVL 677 Score = 52.4 bits (120), Expect = 4e-07 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 2/85 (2%) Frame = +3 Query: 258 KFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNLLD--GVEHFDKTQMKHTTTEEKNPLXX 431 KFD++ LKH +T+EKN LP + + E D V+ F+K++++H T+EKN L Sbjct: 416 KFDAANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPT 475 Query: 432 XXXXXXXXXXNKFLNGIENFDPTKL 506 F +G+E F KL Sbjct: 476 KDTIADEKRTAPF-SGVEVFQKNKL 499 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = +3 Query: 255 EKFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNLLD--GVEHFDKTQMKHTTTEEK 416 E F ++LKH ET EKNPLPD + AE + L D V FD +++KH T+EK Sbjct: 492 EVFQKNKLKHVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEK 547 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = +3 Query: 261 FDSSQLKHTETQEKNPLPDKDVVAAEKA 344 FD S+LKH +T+EKNPLPD +A EKA Sbjct: 722 FDHSKLKHVQTEEKNPLPDAKTIAQEKA 749 Score = 36.7 bits (81), Expect = 0.021 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +2 Query: 398 HDDGRKESTAP-DRSYRSGEGKEQIPERH--RELRSH*AEHTETCEKNSLPTKDVIEQEK 568 H ++++T P D + + ++ P+R + +H ET EKN+LPTKD I EK Sbjct: 424 HVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDTIADEK 483 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = +1 Query: 106 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 225 +P+V D +S++ F+TS L+ V+T EK+V+P+ + + E Sbjct: 521 MPEVLPD-RSEVAKFDTSKLKHVETKEKVVMPTKDVIEAE 559 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 106 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 225 +PK D +S++ F+ + L+ V T EK ++PS ED+ E Sbjct: 597 IPKNKPD-RSEVASFDHTKLKHVTTQEKSIMPSQEDIKEE 635 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 398 HDDGRKESTAPD-RSYRSGEGKEQIPERHRELR--SH*AEHTETCEKNSLPTKDVIEQE 565 H + +++ PD ++ R+ E +P+R + + +H ET EK +PTKDVIE E Sbjct: 501 HVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAE 559 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/92 (19%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = +3 Query: 312 PDKDVVAAEKAHQNLLDGVEHFDKTQMKHTTTEEKNPLXXXXXXXXXXXXNKFLN--GIE 485 P +V + + + V FD +KH T+EKN L ++F + ++ Sbjct: 396 PGSEVAYVDGGSKPDVSEVAKFDAANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVK 455 Query: 486 NFDPTKLNTRKRARRTRSPQRTSLSKRNQLEP 581 +F+ +KL + + P + +++ + P Sbjct: 456 SFEKSKLQHVETKEKNTLPTKDTIADEKRTAP 487 >SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) Length = 413 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 94 SLKDLPKVATDLKSQLEGFNTSCL-RDVDTNEKIVLPSAEDVATEKTQKSLFDGMR 258 SLK L K+ TDL+S ++G ++ L ++V+ K+V + +T K + S F+ + Sbjct: 333 SLKALAKICTDLESNIQGIKSNPLAKEVERTNKLVYEIFKKFSTSKVEASSFENSK 388 >SB_33049| Best HMM Match : 3_5_exonuc (HMM E-Value=0) Length = 470 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +2 Query: 389 DEAHDDGRKESTAPDRSYRSGEGKEQIPERHRELRSH*AEHTETCEKNSLPTKDVIEQE 565 D + D E T P R +G+ + RHR+ + A+H+ ++ P+ DVI Q+ Sbjct: 370 DRSQSDSEPEDTTPLRQKGAGKDNSR-KRRHRKKTGNEAQHSAGSDEEDEPSYDVISQD 427 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 24 ESSIPFLIKNILIQNGLLRE*HSLPERPPQGRHRPEESARRLQHQ 158 E S+PF N QN ++ +P R PQG H + A+ +QH+ Sbjct: 224 EMSLPFKKHNTFRQNVDIK---GIPSRLPQGEHSDRKKAQEVQHK 265 >SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) Length = 982 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/94 (14%), Positives = 45/94 (47%) Frame = +2 Query: 287 RDSGEEPASGQRRCRSGESPPEPLGRS*TLRQDSDEAHDDGRKESTAPDRSYRSGEGKEQ 466 ++ G+ + +++ R E P + L + ++ D+ + +E PD+ + +++ Sbjct: 829 QEQGKPDKNKEKQDREQEKPDKDLEKQYQKQEKPDKGQEKQDREQEKPDKDQEKQDREQE 888 Query: 467 IPERHRELRSH*AEHTETCEKNSLPTKDVIEQEK 568 P++ +E + H E + ++ ++ ++E+ Sbjct: 889 KPDKDQEKQDHEQEKPDKDQEKQDREQEKTDKER 922 >SB_10698| Best HMM Match : bZIP_1 (HMM E-Value=0.01) Length = 590 Score = 24.6 bits (51), Expect(2) = 1.7 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 383 DSDEAHDDGRKESTAPDRSYRSGEGKEQIPERHREL 490 DSD+ +DD +STA R R + + P R L Sbjct: 281 DSDDDYDDREGDSTAKIRKGRRSDTDDLSPNPRRLL 316 Score = 24.2 bits (50), Expect(2) = 1.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 266 FEPAEAHRDSGEE 304 FEP E H DSG+E Sbjct: 266 FEPMEIHDDSGDE 278 >SB_33106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 498 TKLNTRKRARRTRSPQRTSLSKRNQLEPLLY 590 +K +RKRAR T +P+R LS + ++E + Y Sbjct: 77 SKAKSRKRARETTAPKRNCLSLKQRVELINY 107 >SB_16625| Best HMM Match : Death (HMM E-Value=1.5) Length = 528 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 288 ETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 +T E++P DK A +LLDG+ FD+ + +H Sbjct: 261 KTIEQDPTSDKSYKALRDTTHDLLDGLRDFDQAKEEH 297 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 288 ETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 +T E++P +K A +LLDG++HF + + +H Sbjct: 163 KTIEQDPSSEKSYQALRDTTHDLLDGLQHFGQAKEEH 199 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = -3 Query: 231 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFELTLQVCGDLGEVFQGGS 88 GLL+GD+F R K N+ I VD T G + FEL + + E+ GS Sbjct: 74 GLLAGDIFRRPKANILISVDGV-TKG-DKFELPAKASFPVQEMAGLGS 119 >SB_26423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 501 KLNTRKRARRTRSPQRTSLSKRNQ 572 K N+RK+ RR R P+ T LSK+ Q Sbjct: 17 KANSRKKRRRRRRPRLTGLSKQRQ 40 >SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) Length = 1249 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 76 SVSDTPSLKDLPKVATDLKSQLEGFNTSCLRDV-DTNEKIVLPSAEDVAT 222 S SD P+ D A+D+KS + T DV T++ V PSA DV T Sbjct: 617 SASDVPTTSDDQPSASDVKSTSDDQVTPPSSDVPTTSDDQVTPSASDVPT 666 >SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) Length = 426 Score = 29.9 bits (64), Expect = 2.4 Identities = 26/93 (27%), Positives = 36/93 (38%) Frame = +2 Query: 209 KTSPLRRPRSLYSTV*EV*FEPAEAHRDSGEEPASGQRRCRSGESPPEPLGRS*TLRQDS 388 ++S RRPRS + P+ RDS E S + + SPP S S Sbjct: 32 RSSVDRRPRSSRESPERK--RPSSLGRDSSERRPSARVSSDNSRSPPHRRDSSRRSHSPS 89 Query: 389 DEAHDDGRKESTAPDRSYRSGEGKEQIPERHRE 487 + DD R R R +E+ P R R+ Sbjct: 90 RRSSDD-RSTDARDRRDRRRSSSRERRPPRDRD 121 >SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -3 Query: 231 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFEL 136 GLL+GD+F R K N+ I VD T G + FEL Sbjct: 51 GLLAGDIFRRPKANILISVDGV-TKG-DKFEL 80 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 416 ESTAPDRSYRSGEGKEQIPERHR 484 +STA D SY SG G E P HR Sbjct: 483 DSTASDSSYDSGSGPELSPNEHR 505 >SB_13912| Best HMM Match : rRNA_methylase (HMM E-Value=2.6) Length = 692 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 288 ETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 +T E++P +K A +LLDG+ +FD+ + +H Sbjct: 537 KTIEQDPSSEKSYQALRDTTHDLLDGLRYFDQAKEEH 573 >SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 288 ETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 +T E++P +K A +LLDG+ +FD+ +H Sbjct: 567 KTIEQDPSSEKSYQALRDTTHDLLDGLRYFDQASKEH 603 >SB_35592| Best HMM Match : zf-CCHC (HMM E-Value=0.0087) Length = 556 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 288 ETQEKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 +T E++P +K A +LLDG+ +FD+ +H Sbjct: 492 KTIEQDPSSEKSYQALRDTTHDLLDGLRYFDQASKEH 528 >SB_34021| Best HMM Match : Zip (HMM E-Value=0) Length = 808 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 219 H*EDPEVFIRRYEKFDSSQLKHTETQEKNPLPDKDVV 329 H +P+ + +E FDS LKH ++ N +P+ V Sbjct: 370 HEHEPKQDLYHHEDFDSYSLKHERVKQSNTVPNPSKV 406 >SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1028 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 638 LM*VRSICVVHYKFYFCFCTMATLPG 715 L+ V IC VH FY+C C +++ G Sbjct: 55 LVAVLRICSVHLDFYYCTCVWSSMAG 80 >SB_36636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 498 TKLNTRKRARRTRSPQRTSLSKRNQLEPLLY 590 +K +RKRAR T +P+R LS + +++ + Y Sbjct: 78 SKAKSRKRARETTAPKRNCLSLKQRVKLINY 108 >SB_7539| Best HMM Match : Sulfatase (HMM E-Value=3.5e-05) Length = 492 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 226 SQWRRLQQTEAQSFHWCRRHGDSWC*SLRADSSGLWRPW 110 S WRRLQ+ A S + + D +L A+ G W PW Sbjct: 419 SLWRRLQELNATSLEYRLQPEDPRSIAL-AERLGRWEPW 456 >SB_20040| Best HMM Match : DUF293 (HMM E-Value=2.9) Length = 646 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = -1 Query: 470 EFVLFLLRFDSFDRGQWILFFRRRVLHLSLVEVFNSVQEVL 348 +FVL++LRF +D I ++ + HL+LVE + +Q+ L Sbjct: 295 DFVLYMLRFSDYD----IYTGKKSIAHLTLVEFESWLQDEL 331 >SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0) Length = 644 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 595 VTRKCISLVSPYFNIDVSQIDL 660 + KC L+SPY ++D+ DL Sbjct: 13 IAAKCTQLISPYLDLDIKYFDL 34 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 97 LKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 225 L DL +V +LKS+ EG CL D++ + DV E Sbjct: 1125 LMDLSRVGEELKSENEGLQQKCL-DLEKQRDTIKQDLADVQKE 1166 >SB_16870| Best HMM Match : Methyltransf_3 (HMM E-Value=1) Length = 766 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 297 EKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 E++P +K A +LLDG+ +FD+ + +H Sbjct: 75 EQDPKSEKSYQALRDTTHDLLDGLRYFDQAKEEH 108 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 297 EKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 E++P +K A +LLDG+ +FD+ + +H Sbjct: 173 EQDPKSEKSYQALRDTTHDLLDGLRYFDQAKEEH 206 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 297 EKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 E++P +K A +LLDG+ +FD+ + +H Sbjct: 222 EQDPKSEKSYQALRDTTHDLLDGLRYFDQAKEEH 255 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 297 EKNPLPDKDVVAAEKAHQNLLDGVEHFDKTQMKH 398 E++P +K A +LLDG+ +FD+ + +H Sbjct: 320 EQDPKSEKSYQALRDTTHDLLDGLRYFDQAKEEH 353 >SB_5478| Best HMM Match : NDT80_PhoG (HMM E-Value=3.6e-21) Length = 781 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 41 PHQKYIDSEWPAP*VTLPP*KTSPRSPQT*RVSSKASTPAVSVTSTP 181 P + + E P P + L P T+ P+ V +ASTP S +P Sbjct: 517 PRNSFAEYEKPLPTLPLSPTNTTTGRPRLSTVPPEASTPTDSFPKSP 563 >SB_52306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/71 (25%), Positives = 28/71 (39%) Frame = +2 Query: 272 PAEAHRDSGEEPASGQRRCRSGESPPEPLGRS*TLRQDSDEAHDDGRKESTAPDRSYRSG 451 P + HR S + +G+R G+ PE R ++ + E + T G Sbjct: 75 PEKQHRGSVHKRGNGER----GQGSPEKQQRGSVHKRGNGEGKSSPENQHTGSIYKRGKG 130 Query: 452 EGKEQIPERHR 484 EGK +HR Sbjct: 131 EGKSSPENQHR 141 >SB_36993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 9.8 Identities = 22/98 (22%), Positives = 34/98 (34%), Gaps = 2/98 (2%) Frame = +2 Query: 278 EAHRDSGEEPA--SGQRRCRSGESPPEPLGRS*TLRQDSDEAHDDGRKESTAPDRSYRSG 451 EA RD +E S R + G R DEA DG E+T + Sbjct: 73 EATRDGNDEATRDSHDEATRDSQDEAARDGHDEATRDSHDEATRDGHDEATRDSHDEATR 132 Query: 452 EGKEQIPERHRELRSH*AEHTETCEKNSLPTKDVIEQE 565 +G ++ + + + T + + T DV E Sbjct: 133 DGNDEATRDSHDRATRDSHDRATRDSHDRATLDVTGDE 170 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 27.9 bits (59), Expect = 9.8 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Frame = +2 Query: 287 RDSGEEPASGQRRCRSG-ESPPEPLGRS*TLRQDSDEAHDDGRKESTAPDRSYRSGEGKE 463 +DS E ++ R G E + + ++ ++ DE DD + D SG+GK+ Sbjct: 795 KDSSESEKGKAKKQRKGREKKGKEIKKNDDEEEERDEEEDDEEDDDEEDDSKKASGKGKK 854 Query: 464 QIPERHRELRSH*AEHTETCEKNSLPTK 547 + ++ +S + E E++ TK Sbjct: 855 G-QDNKKKGKSKKDDEDEEAEEDGEKTK 881 >SB_7966| Best HMM Match : DNA_ligase_A_C (HMM E-Value=4.8) Length = 199 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = +3 Query: 477 GIENFD--PTKLNTRKRARRTRSPQ 545 GIE+ D P KL+ RKR RRT S Q Sbjct: 172 GIEHIDEEPKKLDARKRKRRTISSQ 196 >SB_53576| Best HMM Match : SCAN (HMM E-Value=2.3) Length = 334 Score = 27.9 bits (59), Expect = 9.8 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%) Frame = +2 Query: 296 GEEPASGQRR----CRSGESPPEPLGRS*T-LRQDSDEAHDDGRK---ESTAPDRSYRSG 451 GEEP+S S + P P+ + + +D D+ +G + ES A DRS+ SG Sbjct: 181 GEEPSSRTETPDLYILSNDIPTSPVDEAPLPVDEDDDDEQVNGLRMLPESVALDRSHESG 240 Query: 452 EGKEQIP 472 G +P Sbjct: 241 RGTPHLP 247 >SB_15442| Best HMM Match : rve (HMM E-Value=0.00084) Length = 822 Score = 27.9 bits (59), Expect = 9.8 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 7/75 (9%) Frame = +3 Query: 213 RRH*EDPEVFIRRYEKFDSS---QLKHTETQEKNPLPDKD----VVAAEKAHQNLLDGVE 371 + H DP FIR Y ++ + L+ + P KD +A EKA + ++DG Sbjct: 690 KTHKSDPVAFIRGYHEYMTEWEPALEDVYKLMRQPTNIKDPNAVAIAREKADKTVMDGDV 749 Query: 372 HFDKTQMKHTTTEEK 416 + +Q + T EK Sbjct: 750 GYQISQEQRPTNCEK 764 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,297,772 Number of Sequences: 59808 Number of extensions: 520257 Number of successful extensions: 1800 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1786 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -