BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20367 (802 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 6.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.7 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 8.7 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 366 SKVMLTQSKTNFRIRKNLVLRLL 434 S+ ML Q+K IRKNLV + L Sbjct: 388 SREMLQQNKILKVIRKNLVKKCL 410 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = -1 Query: 454 HLCLVVISNLSTKFFLILKLVFD*VSITFELVSRLHS 344 H+C I + K + + F VS + EL+ ++ + Sbjct: 1014 HVCYATIQEVRAKIYFFYLVKFYKVSKSGELIHKIET 1050 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = -1 Query: 454 HLCLVVISNLSTKFFLILKLVFD*VSITFELVSRLHS 344 H+C I + K + + F VS + EL+ ++ + Sbjct: 295 HVCYATIQEVRAKIYFFYLVKFYKVSKSGELIHKIET 331 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,936 Number of Sequences: 336 Number of extensions: 3080 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -