BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20360 (688 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.8 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 23 2.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/46 (21%), Positives = 21/46 (45%) Frame = +3 Query: 354 TIDVKPFKPSSAECLCSVTLEADFMMKKTTSTDPYDSEQMARDFLI 491 T++ KP+ LC + + ++ T +P D + M D ++ Sbjct: 64 TLNCHRMKPALFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNML 109 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 472 WPEISLFSSPIKFYCRTTAGFLVPREESLVV 564 +P + L S + RT G+L+P++ ++ Sbjct: 59 YPSVHLISRALGEDVRTQKGYLIPKDTITII 89 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -1 Query: 457 YGSVDVVFFIMKSASKVTLQRHSALEGLKGFTS 359 YG D F +K+T + L GLK +T+ Sbjct: 1140 YGPSDTWFDENTKDTKITAASETILHGLKKYTN 1172 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 231 NMLDVTWKVILMY*STVGDGKLIRWTFGCF 142 +ML + +++ILM + +G G + G F Sbjct: 879 SMLYIGYQIILMIGTVIGPGTIFLMLVGAF 908 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 231 NMLDVTWKVILMY*STVGDGKLIRWTFGCF 142 +ML + +++ILM + +G G + G F Sbjct: 879 SMLYIGYQIILMIGTVIGPGTIFLMLVGAF 908 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,828 Number of Sequences: 336 Number of extensions: 3095 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -