BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS20355
(645 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 2.5
AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 4.4
>DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly
protein 9 protein.
Length = 423
Score = 23.0 bits (47), Expect = 2.5
Identities = 11/31 (35%), Positives = 15/31 (48%)
Frame = +1
Query: 220 YNNIAYGYILHRVINFRINSCAANSKASHTR 312
Y IA G + +NFRI + N +TR
Sbjct: 380 YQKIANGDLNFNEVNFRILNAPVNQLIRYTR 410
>AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic
acetylcholine receptoralpha-3 protein.
Length = 537
Score = 22.2 bits (45), Expect = 4.4
Identities = 8/11 (72%), Positives = 10/11 (90%)
Frame = -3
Query: 184 VSDYPIEVKNS 152
VSDYP+E+K S
Sbjct: 395 VSDYPLELKGS 405
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,187
Number of Sequences: 438
Number of extensions: 3038
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19438227
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -