SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20355
         (645 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    23   2.5  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    22   4.4  

>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = +1

Query: 220 YNNIAYGYILHRVINFRINSCAANSKASHTR 312
           Y  IA G +    +NFRI +   N    +TR
Sbjct: 380 YQKIANGDLNFNEVNFRILNAPVNQLIRYTR 410


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = -3

Query: 184 VSDYPIEVKNS 152
           VSDYP+E+K S
Sbjct: 395 VSDYPLELKGS 405


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,187
Number of Sequences: 438
Number of extensions: 3038
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19438227
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -