BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20355 (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51000.1 68418.m06323 F-box family protein contains F-box dom... 27 8.1 At5g45840.1 68418.m05639 leucine-rich repeat transmembrane prote... 27 8.1 >At5g51000.1 68418.m06323 F-box family protein contains F-box domain Pfam:PF00646 Length = 378 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 390 CPGLPLL*CCDSDNNS*LMIWYE*PYASMRR 298 C GL LL C+ +NS LM+W PY R Sbjct: 100 CDGLLLLLLCNPKDNSKLMVWN--PYLGQTR 128 >At5g45840.1 68418.m05639 leucine-rich repeat transmembrane protein kinase, putative and genscan+ Length = 668 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 244 CIRMLYYYNVRACSYNKQYIVSDYPIEVKNSVLQR 140 C+ Y VR S+ K Y+V+ +P E + S+ +R Sbjct: 193 CVNRKLGYWVRRESHGKNYVVNYHPSENETSIFKR 227 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,739,799 Number of Sequences: 28952 Number of extensions: 211174 Number of successful extensions: 391 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -