BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20351 (709 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 95 3e-20 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 93 1e-19 At2g33590.1 68415.m04117 cinnamoyl-CoA reductase family similar ... 31 0.75 At1g02065.2 68414.m00127 squamosa promoter-binding protein-like ... 30 1.7 At1g02065.1 68414.m00128 squamosa promoter-binding protein-like ... 30 1.7 At3g18640.1 68416.m02368 zinc finger protein-related contains si... 29 2.3 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.3 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 5.3 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 7.0 At5g01010.1 68418.m00001 expressed protein 28 7.0 At3g60300.1 68416.m06740 RWD domain-containing protein contains ... 28 7.0 At3g25840.1 68416.m03219 protein kinase family protein contains ... 28 7.0 At5g40370.1 68418.m04897 glutaredoxin, putative similar to gluta... 27 9.2 At4g11230.1 68417.m01819 respiratory burst oxidase, putative / N... 27 9.2 At1g10410.1 68414.m01173 expressed protein similar to ESTs gb|N9... 27 9.2 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 95.5 bits (227), Expect = 3e-20 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 2/79 (2%) Frame = +1 Query: 25 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 198 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 199 KEAGHQTSAESWGTGRAVA 255 K+AGHQTSAESWGTGRAV+ Sbjct: 61 KKAGHQTSAESWGTGRAVS 79 Score = 83.8 bits (198), Expect = 1e-16 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 255 RIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 368 RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 80 RIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 54.4 bits (125), Expect = 7e-08 Identities = 25/57 (43%), Positives = 36/57 (63%) Frame = +1 Query: 493 SRQSPEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRKGPLIIF 663 S + + KT A+ L+++ A+ D K S +R GKGKMRNRR I RKGPL+++ Sbjct: 160 SDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVY 216 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +2 Query: 410 SVAATGVPALVQARGHIIEKIPELPLVVADKVQ 508 ++AAT VPALV ARGH IE +PE+PLVV+D + Sbjct: 132 AIAATAVPALVMARGHKIENVPEMPLVVSDSAE 164 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 93.5 bits (222), Expect = 1e-19 Identities = 46/76 (60%), Positives = 54/76 (71%), Gaps = 2/76 (2%) Frame = +1 Query: 34 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 207 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 208 GHQTSAESWGTGRAVA 255 GHQTSAESWGTGRAV+ Sbjct: 65 GHQTSAESWGTGRAVS 80 Score = 83.8 bits (198), Expect = 1e-16 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 255 RIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 368 RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 81 RIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 55.6 bits (128), Expect = 3e-08 Identities = 26/57 (45%), Positives = 36/57 (63%) Frame = +1 Query: 493 SRQSPEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRKGPLIIF 663 S + + KT A+ L+++ A+ D K S +R GKGKMRNRR I RKGPL++F Sbjct: 161 SDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVF 217 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +2 Query: 410 SVAATGVPALVQARGHIIEKIPELPLVVADKVQ 508 ++AAT VPALV ARGH IE +PE+PLVV+D + Sbjct: 133 AIAATAVPALVMARGHKIENVPEMPLVVSDSAE 165 >At2g33590.1 68415.m04117 cinnamoyl-CoA reductase family similar to cinnamoyl-CoA reductase from Pinus taeda [GI:17978649], Eucalyptus gunnii [GI:2058311] Length = 321 Score = 31.1 bits (67), Expect = 0.75 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 2/83 (2%) Frame = -2 Query: 645 LTLDTTTVAHFTLTSTKTLRLVHLKDIRPCLEAPQEDDSLF--GLVDLWTLSATTRGSSG 472 L L H T+ + HLK LE + LF L+D +L + G SG Sbjct: 25 LLLSKDYFVHGTVRDPDNEKYAHLKK----LEKAGDKLKLFKADLLDYGSLQSAIAGCSG 80 Query: 471 IFSIMCPLA*TSAGTPVAATLPP 403 +F + CP+ S P + P Sbjct: 81 VFHVACPVPPASVPNPEVELIAP 103 >At1g02065.2 68414.m00127 squamosa promoter-binding protein-like 8 (SPL8) identical to squamosa promoter binding protein-like 8 [Arabidopsis thaliana] GI:5931679; contains Pfam profile PF03110: SBP domain Length = 246 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 327 HHDTCYRR--HPDRTYEYHHHGHAEFGDSTSSTP 232 HH T Y + ++ +HHH H+ +G +T++TP Sbjct: 63 HHLTLYGQTNSNNQFLHHHHHHHSLYGSTTTTTP 96 >At1g02065.1 68414.m00128 squamosa promoter-binding protein-like 8 (SPL8) identical to squamosa promoter binding protein-like 8 [Arabidopsis thaliana] GI:5931679; contains Pfam profile PF03110: SBP domain Length = 333 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 327 HHDTCYRR--HPDRTYEYHHHGHAEFGDSTSSTP 232 HH T Y + ++ +HHH H+ +G +T++TP Sbjct: 63 HHLTLYGQTNSNNQFLHHHHHHHSLYGSTTTTTP 96 >At3g18640.1 68416.m02368 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 676 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +2 Query: 335 VRPHEALAALAPSRQPPTAESGLGGSVAATGVPALVQARGHIIEKIPELPL 487 V+P++A P GLG S A GVPA+ ++ +E+I E+ L Sbjct: 488 VQPNQATTQSNVVSSNPNQLWGLGMSTGAEGVPAVTASKISNVEEIQEVSL 538 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +1 Query: 49 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 195 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 100 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 195 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 100 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 195 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 327 HHDTCYRRHPDRTYEYHHHGHAEF 256 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -2 Query: 225 STGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 94 +TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 203 ATGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At3g60300.1 68416.m06740 RWD domain-containing protein contains weak similarity to RING finger protein 25 (RING finger protein AO7) (Swiss-Prot:Q9QZR0) [Mus musculus] Length = 366 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 598 RAGKGKMRNRRRIQRKGPLIIFNKGSGSDSRLP 696 R G+G+ R R R + +GP + K + D R P Sbjct: 321 RRGRGRWRGRGRSRGRGPTVNERKPNSQDPRKP 353 >At3g25840.1 68416.m03219 protein kinase family protein contains Pfam profile: PF00069 eukaryotic protein kinase domain Length = 935 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -2 Query: 309 RRHPDRTYEYHHHGHAEFGDSTSSTP*FSTGLVTSLLAHAVGLPRVLGH 163 +RH R +++HHH H D S G T +L P V+ + Sbjct: 29 KRHKHRHHKHHHHRHRHHRDKKRENEIPSAGDETEILDVTPAAPIVVSN 77 >At5g40370.1 68418.m04897 glutaredoxin, putative similar to glutaredoxin [Ricinus communis] SWISS-PROT:P55143 Length = 111 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 240 WTCCRRIPRVRGGGTHRSGQGAFGNMCRGGRM 335 WT R +P V GG H G A N+ + G++ Sbjct: 61 WTGQRTVPNVFIGGNHIGGCDATSNLHKDGKL 92 >At4g11230.1 68417.m01819 respiratory burst oxidase, putative / NADPH oxidase, putative similar to respiratory burst oxidase homolog F [gi:3242456], RbohAp108 [gi:2654868] from Arabidopsis thaliana, respiratory burst oxidase homolog [GI:16549087] from Solanum tuberosum; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 941 Score = 27.5 bits (58), Expect = 9.2 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +2 Query: 347 EALAALAPSRQPPTAESGLGGSVAATGVPA-LVQARGHIIEKIPELPLVVADKVQRSTRP 523 E L A S+Q S G ++ P +V RG I + + LP ++ QR TRP Sbjct: 103 ERLTAGTNSKQQIQKISRRGYGYSSRSAPEPVVPHRGEITDSV-NLPRALS---QRPTRP 158 Query: 524 NRLSSS*GASRHGL 565 NR S + HGL Sbjct: 159 NRDGSGTERAIHGL 172 >At1g10410.1 68414.m01173 expressed protein similar to ESTs gb|N96021 and gb|N96863 Length = 485 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 592 RLRAGKG-KMRNRRRIQRKGPLIIFNKGSGSDSRLPQHPR 708 +LR+ K K R RR+IQRK + GS L H R Sbjct: 15 KLRSSKRRKSRRRRKIQRKRAAVSSRLSDGSFDNLDHHHR 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,717,618 Number of Sequences: 28952 Number of extensions: 299443 Number of successful extensions: 1025 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -