BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20335 (615 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0171 - 7427862-7428293 29 2.2 09_02_0133 + 4707944-4708308,4708320-4708534,4708626-4708672,470... 28 5.1 >02_02_0171 - 7427862-7428293 Length = 143 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -1 Query: 549 PKLTSFLPFFLIYINSYNKHNSFVLPTHAHP 457 P +T+ F LI +NS + +S +L +H+HP Sbjct: 65 PSVTNQRQFHLIVVNSSSISSSLILHSHSHP 95 >09_02_0133 + 4707944-4708308,4708320-4708534,4708626-4708672, 4708997-4709393,4710042-4710608,4710708-4710838, 4711274-4711747 Length = 731 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 70 YKIELNANVSPSTGRHTVART 8 YKIELN NV+P R+ V T Sbjct: 79 YKIELNTNVTPDQRRYNVPTT 99 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,187,332 Number of Sequences: 37544 Number of extensions: 248701 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -