BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20335 (615 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 27 0.48 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 27 0.48 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 24 4.5 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 24 4.5 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 7.8 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 27.1 bits (57), Expect = 0.48 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = -2 Query: 296 LQKLRLQSKNLKIITKMPKN*KHNFIGQRRRFHC-STSIVFEKNCVRDLTSTTSVNQ 129 L K+ + L + K P + +H FI + + I+FE + +RDL ST + + Sbjct: 33 LDKVLSAQRMLSVEGKKPVHDEHLFIVTHQAYELWFKQIIFELDSIRDLFSTEHIEE 89 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 27.1 bits (57), Expect = 0.48 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = -2 Query: 296 LQKLRLQSKNLKIITKMPKN*KHNFIGQRRRFHC-STSIVFEKNCVRDLTSTTSVNQ 129 L K+ + L + K P + +H FI + + I+FE + +RDL ST + + Sbjct: 33 LDKVLSAQRMLSVEGKKPVHDEHLFIVTHQAYELWFKQIIFELDSIRDLFSTEHIEE 89 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 97 YDCRDEPTADCWFTEVVEVKSRTQFFSKTILV 192 Y C EP D FT ++++ RT ++ ++V Sbjct: 211 YQCCPEPYVDITFT--IQIRRRTLYYFFNLIV 240 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 97 YDCRDEPTADCWFTEVVEVKSRTQFFSKTILV 192 Y C EP D FT ++++ RT ++ ++V Sbjct: 211 YQCCPEPYVDITFT--IQIRRRTLYYFFNLIV 240 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.0 bits (47), Expect = 7.8 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 528 PFFLIYINSYNKHNSFVLPTHAHPSLLTMKCC 433 P Y+N+ + + F+L H P L + CC Sbjct: 564 PIIYCYMNARFR-SGFILVLHGVPGLQQLCCC 594 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 586,876 Number of Sequences: 2352 Number of extensions: 10953 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -