BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20334 (463 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40799-4|AAA81482.1| 426|Caenorhabditis elegans Hypothetical pr... 28 2.8 Z70682-6|CAH60781.2| 401|Caenorhabditis elegans Hypothetical pr... 27 4.9 Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr... 27 6.5 Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p... 27 6.5 AF022967-5|AAB69878.1| 537|Caenorhabditis elegans Hypothetical ... 27 8.6 >U40799-4|AAA81482.1| 426|Caenorhabditis elegans Hypothetical protein F42C5.2 protein. Length = 426 Score = 28.3 bits (60), Expect = 2.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 374 LCVLSRPWTAANTKCYRAPEMRVRRDLQK 288 LC P TA N KC ++R++ +L+K Sbjct: 20 LCKFDEPVTANNVKCVTIVDLRLKLELEK 48 >Z70682-6|CAH60781.2| 401|Caenorhabditis elegans Hypothetical protein F08G5.7 protein. Length = 401 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 218 GQRRRFHCSTSI-VFEKNCVRDLTSTTSVNQQSAVGSSLQS 99 GQ + C SI + K C R+ TSTT+V + +++++ Sbjct: 183 GQTNAYSCDESIQIICKYCPRETTSTTTVTPTTTKAATIKT 223 >Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical protein ZK945.9 protein. Length = 3178 Score = 27.1 bits (57), Expect = 6.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 188 SIVFEKNCVRDLTSTTSVNQQSAVGSSLQS 99 S +F N V D TST+ V ++ GSS +S Sbjct: 860 SHIFTLNVVADSTSTSEVTSTTSTGSSSES 889 >Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical protein ZK945.9 protein. Length = 3178 Score = 27.1 bits (57), Expect = 6.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 188 SIVFEKNCVRDLTSTTSVNQQSAVGSSLQS 99 S +F N V D TST+ V ++ GSS +S Sbjct: 860 SHIFTLNVVADSTSTSEVTSTTSTGSSSES 889 >AF022967-5|AAB69878.1| 537|Caenorhabditis elegans Hypothetical protein C13A2.6 protein. Length = 537 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 308 VRRDLQKLRLQSKNLKIITKMP 243 + RDL K+R SK +KI +K+P Sbjct: 435 IDRDLAKIRKSSKVMKIASKLP 456 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,918,962 Number of Sequences: 27780 Number of extensions: 175098 Number of successful extensions: 416 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 818426686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -