BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20323 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 64 1e-10 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 56 3e-08 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 55 6e-08 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 53 2e-07 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 9e-06 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 43 3e-04 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 42 3e-04 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 40 0.001 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 39 0.004 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 38 0.007 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 36 0.023 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 36 0.023 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 36 0.023 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 35 0.053 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 35 0.070 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 34 0.092 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 32 0.37 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 31 1.1 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.5 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 29 3.5 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.5 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 29 4.6 SB_15074| Best HMM Match : PID (HMM E-Value=0.00012) 28 8.0 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/89 (34%), Positives = 47/89 (52%) Frame = +1 Query: 250 PSWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPD 429 P + +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 430 YVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 + ++ + Y +PT IQ Q PIA+ R Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGR 555 Score = 64.9 bits (151), Expect = 6e-11 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQI 667 ++TGSGKT A++ PA+VHI +QP ++ DGPI L+ APTREL QQI Sbjct: 561 AKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQI 606 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +2 Query: 560 YILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQVA 679 +ILP IVHIN+QP ++ DGPI LVL PTRELAQQ+Q+VA Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVA 152 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +1 Query: 322 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 489 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 56.0 bits (129), Expect = 3e-08 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 4/52 (7%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSD----GPIALVLAPTRELAQQIQQ 673 ++TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ Sbjct: 145 AETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEE 196 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/57 (36%), Positives = 33/57 (57%) Frame = +1 Query: 346 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + R Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 54.8 bits (126), Expect = 6e-08 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQI 667 ++TGSGKTLAY LP + + + P D P+AL+L PTREL QQ+ Sbjct: 116 AETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/79 (29%), Positives = 38/79 (48%) Frame = +1 Query: 280 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 459 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 460 YKEPTPIQAQGWPIAMLER 516 ++ PTPIQ Q M R Sbjct: 92 FQVPTPIQMQSLSCVMSGR 110 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 1/86 (1%) Frame = +1 Query: 262 SVSLQPFNKNFYDPHPTVLKRSPYEVEEYR-NKHEVTVSGVEVHNPIQYFEEANFPDYVQ 438 +V QPF K+FY P + K +P E +E+R + + V G P++ + + + Sbjct: 58 TVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKIL 117 Query: 439 QGVKTMGYKEPTPIQAQGWPIAMLER 516 +K Y++PTPIQAQ P+ M R Sbjct: 118 DVLKKNSYEKPTPIQAQAIPVIMSGR 143 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 548 KTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQ 673 K +Y P + P I IA+V+ PTRELA QI + Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHR 162 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 53.2 bits (122), Expect = 2e-07 Identities = 24/74 (32%), Positives = 40/74 (54%) Frame = +1 Query: 295 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 474 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 475 PIQAQGWPIAMLER 516 PIQ Q P+ + R Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQI 667 +QTGSGKT AY+LP + + Q P+AL +APTRELA+QI Sbjct: 523 AQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQI 568 Score = 34.7 bits (76), Expect = 0.070 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +1 Query: 370 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 VSG I F E F + + + GY+ PTP+Q PI M R Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = +1 Query: 334 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 501 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/48 (41%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +2 Query: 527 RSQTGSGKTLAYILPAIVHINN-QPPIRRSDGPIALVLAPTRELAQQI 667 +++TG+GKTL++ LP + + + + +R P LV+APTRELA+Q+ Sbjct: 116 QARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQV 163 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/49 (48%), Positives = 33/49 (67%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQV 676 ++TGSGKTLA+++P I + Q DG ALV++PTRELA Q +V Sbjct: 94 AKTGSGKTLAFLIPIIETLWRQ-KWTSMDGLGALVISPTRELAYQTFEV 141 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +2 Query: 527 RSQTGSGKTLAYILPAIVHIN-NQPPIRRSDGPIALVLAPTRELAQQIQQV 676 ++Q+G+GKT + + + I+ N D ALVLAPTRELAQQIQ+V Sbjct: 128 QAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKV 178 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 4/50 (8%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINN----QPPIRRSDGPIALVLAPTRELAQQI 667 +QTGSGKT A++LP + + N + P A+ +APTRELA QI Sbjct: 755 AQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQI 804 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/59 (38%), Positives = 31/59 (52%) Frame = +1 Query: 340 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI + R Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPP----IRRSDGPIALVLAPTRELAQQIQQVA 679 +QTGSGKTLAY+ P + + + R P A ++ P RELA QI + A Sbjct: 422 AQTGSGKTLAYLAPLVHRLREDEERHGILARLKRPRACIVVPARELATQILKTA 475 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/50 (46%), Positives = 34/50 (68%) Frame = +2 Query: 527 RSQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQV 676 ++Q+G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V Sbjct: 40 QAQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKV 84 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/50 (38%), Positives = 34/50 (68%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQVA 679 ++TGSGKTLA+++P +V + + + +G ++++PTREL+ Q VA Sbjct: 616 AKTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVA 664 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/59 (38%), Positives = 31/59 (52%) Frame = +1 Query: 340 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI + R Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 37.9 bits (84), Expect = 0.007 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQI 667 ++TGSGKT A+ LP + + + P G A+VL PTRELA QI Sbjct: 51 AKTGSGKTAAFALPILQKLCDDP-----YGIFAVVLTPTRELAFQI 91 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 37.5 bits (83), Expect = 0.010 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 14/61 (22%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHI--------NNQPPIRRSD------GPIALVLAPTRELAQQI 667 ++TGSGKTLA+ +P I HI P + SD +AL++APTRELA Q+ Sbjct: 175 AETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQV 234 Query: 668 Q 670 + Sbjct: 235 K 235 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQ 673 ++TGSGKT A+++P + G AL+L+PTRELA Q Q+ Sbjct: 325 ARTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQK 369 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 36.3 bits (80), Expect = 0.023 Identities = 21/48 (43%), Positives = 29/48 (60%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQ 673 ++TGSGKT A+ LP + + + P AL+L PTRELA QI + Sbjct: 8 AETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISE 50 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 36.3 bits (80), Expect = 0.023 Identities = 21/58 (36%), Positives = 32/58 (55%) Frame = +2 Query: 503 LCWKEFSWRSQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQV 676 L ++ R++ G+GKT AY++P + + + ALVL PTRELA Q Q+ Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQI 134 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 36.3 bits (80), Expect = 0.023 Identities = 21/58 (36%), Positives = 32/58 (55%) Frame = +2 Query: 503 LCWKEFSWRSQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQV 676 L ++ R++ G+GKT AY++P + + + ALVL PTRELA Q Q+ Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQI 134 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 35.1 bits (77), Expect = 0.053 Identities = 19/51 (37%), Positives = 31/51 (60%) Frame = +2 Query: 527 RSQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQIQQVA 679 +SQ+G+GKT A++L + ++ P P + L+PT ELA+Q +VA Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVA 193 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = +1 Query: 355 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLE 513 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ + + Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLAD 140 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 34.7 bits (76), Expect = 0.070 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +2 Query: 536 TGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQ 664 TG+GKT A++LP + + +P +S LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 34.3 bits (75), Expect = 0.092 Identities = 19/47 (40%), Positives = 31/47 (65%) Frame = +2 Query: 527 RSQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPTRELAQQI 667 +S+TG+GK+L ++LP++ Q P R G +++ PTRELA Q+ Sbjct: 203 KSETGTGKSLVFLLPSV-----QDPGR---GYGTIIVVPTRELASQM 241 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 620 PIALVLAPTRELAQQIQQV 676 P ALVL+PTRELA QIQ+V Sbjct: 4 PQALVLSPTRELANQIQKV 22 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +1 Query: 382 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLERI*LA*PNGF 543 ++H P++ + FP Y + Y P P QA W LER+ PNG+ Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW----LERV---RPNGW 52 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 397 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 I FE+ + + + V GYK+PTP+Q PI +R Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKR 913 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHINNQPP 601 +QTGSGKT A+++P + I + P Sbjct: 919 AQTGSGKTAAFLIPILSRIYMEGP 942 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 3/70 (4%) Frame = +2 Query: 476 PFKLKA---GR*LCWKEFSWRSQTGSGKTLAYILPAIVHINNQPPIRRSDGPIALVLAPT 646 P +LKA GR C + ++++G+GKT + + A+ ++ I S+ ++L PT Sbjct: 38 PIQLKAIPLGR--CGLDLIAQAKSGTGKTCVFSVIALENV-----ITESNCIQIIILTPT 90 Query: 647 RELAQQIQQV 676 RE+A Q++ V Sbjct: 91 REIAVQVKDV 100 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 328 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 459 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 212 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 102 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +2 Query: 539 GSGKTLAYILPAIVHINNQPPIRR---SDGPIALVL 637 GSGK LAY+LP I I + ++GP+ L+L Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLIL 269 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 340 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 432 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 277 VGVKQNPNWASHVLPSREF 221 VGV+ WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -3 Query: 278 GWSETESQLGVACS--ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFH 108 GW T + S AL+RI + ++ C +YRR CC L +W H + Sbjct: 181 GWRVTLRVIAATTSQQALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTN 239 Query: 107 GYYSN 93 Y+S+ Sbjct: 240 TYWSS 244 >SB_15074| Best HMM Match : PID (HMM E-Value=0.00012) Length = 1153 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 447 KDNGLQRTDAHSSSRLADSYVGKNLVGVAKRVPAKR 554 K +GL+R + S RLA +G +L K VP +R Sbjct: 576 KGSGLERPKSLSLKRLASGSLGLHLAKFVKSVPVQR 611 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,342,936 Number of Sequences: 59808 Number of extensions: 425291 Number of successful extensions: 1207 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -