BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20323 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 48 1e-07 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 8.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.2 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 47.6 bits (108), Expect = 1e-07 Identities = 22/49 (44%), Positives = 28/49 (57%) Frame = +1 Query: 361 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAM 507 +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M Sbjct: 183 QVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIM 231 Score = 29.9 bits (64), Expect = 0.023 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Frame = +2 Query: 530 SQTGSGKTLAYILPAIVHI--NNQPPIRRSD--GPIALVLAPTRELAQQIQQ 673 +QTGSGKT A+ +P I + + + S P ++++PTREL QI Q Sbjct: 240 AQTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQ 291 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 319 KRSPYEVEEYRNKHEVTV 372 K P++V+++R+K VT+ Sbjct: 64 KNYPFDVDQWRDKTFVTI 81 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 167 TETNYRRICCLLQIWNHRFHGYYSN 93 T N RR ++ W H F Y N Sbjct: 416 TVENNRRNPWFVEFWEHHFQCRYPN 440 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,772 Number of Sequences: 438 Number of extensions: 3950 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -