BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20322 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 64 7e-11 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 60 2e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 57 1e-08 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 4e-06 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 48 9e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 3e-04 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 39 0.003 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 34 0.11 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 34 0.11 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.26 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 31 0.80 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 30 1.4 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 28 7.4 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 28 7.4 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 64.5 bits (150), Expect = 7e-11 Identities = 40/112 (35%), Positives = 59/112 (52%), Gaps = 6/112 (5%) Frame = +1 Query: 250 RRYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 429 R +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++ Sbjct: 81 RIFREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRD 140 Query: 430 LVGVP---NGFRQNVGLHLASHCAHK*PTAIRRGD---GPIALVLAPTRELA 567 ++GV +G + L P R D GP AL+LAPTRELA Sbjct: 141 IIGVAETGSGKTAAFAIPLLVWIMGL-PKIERDNDADQGPYALILAPTRELA 191 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/103 (33%), Positives = 50/103 (48%), Gaps = 1/103 (0%) Frame = +1 Query: 259 RNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG 438 R K + VSG P F F + + ++ + Y +PT IQ Q PIA+SG++++G Sbjct: 500 RKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIG 559 Query: 439 VPNGFRQNVGLHLASHCAH-K*PTAIRRGDGPIALVLAPTREL 564 + L H ++ GDGPI L+ APTREL Sbjct: 560 IAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTREL 602 Score = 39.5 bits (88), Expect = 0.002 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +2 Query: 161 PDWDSVSLQPFNKNFYDPHPTVLKRSPYEVEGI 259 P+ + +PFNKNFY+ HP + K+S E++ + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDL 499 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 59.7 bits (138), Expect = 2e-09 Identities = 41/104 (39%), Positives = 52/104 (50%) Frame = +1 Query: 256 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 435 YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ + G Sbjct: 65 YRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ---FILPG---- 117 Query: 436 GVPNGFRQNVGLHLASHCAHK*PTAIRRGDGPIALVLAPTRELA 567 H H+ ++ GDGPI LVL PTRELA Sbjct: 118 --------------IVHINHQ--PLLQPGDGPIVLVLCPTRELA 145 Score = 33.9 bits (74), Expect = 0.11 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 4/61 (6%) Frame = +2 Query: 470 YILPAIVHINNQPLF----GEVMVRLLWSWRLPES*HNKFSSCCRFGHTSYVRNTCVFGG 637 +ILP IVHIN+QPL G +++ L + L + S G +R+TC++GG Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYS---VGKHCKLRSTCIYGG 169 Query: 638 A 640 A Sbjct: 170 A 170 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.8 bits (131), Expect = 1e-08 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 1/103 (0%) Frame = +1 Query: 259 RNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG 438 R K+ + + G + PI+ F + N P + + ++ PTPIQ Q MSG++++G Sbjct: 55 RWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLSCVMSGRDIIG 114 Query: 439 V-PNGFRQNVGLHLASHCAHK*PTAIRRGDGPIALVLAPTREL 564 + G + + L + GD P+AL+L PTREL Sbjct: 115 LAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTREL 157 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = +1 Query: 256 YRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSG 423 +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ G Sbjct: 141 FRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPLMAHG 200 Query: 424 KNLVG 438 G Sbjct: 201 PKKSG 205 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/62 (32%), Positives = 37/62 (59%) Frame = +1 Query: 250 RRYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 429 ++ R+K E+ V G V +P+ F +F + + + + GY PTPIQ Q P+ +SG++ Sbjct: 176 KQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPTPIQMQVLPVLLSGRD 235 Query: 430 LV 435 ++ Sbjct: 236 VM 237 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 46.4 bits (105), Expect = 2e-05 Identities = 32/101 (31%), Positives = 48/101 (47%), Gaps = 5/101 (4%) Frame = +1 Query: 280 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVPNGFRQ 459 VSG I F E F + + + GY+ PTP+Q PI M+G++L+ Q Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMAC----AQ 524 Query: 460 NVGLHLASHCAHK*PTAIRRG-----DGPIALVLAPTRELA 567 A++ + I++G P+AL +APTRELA Sbjct: 525 TGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELA 565 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 45.2 bits (102), Expect = 5e-05 Identities = 33/104 (31%), Positives = 49/104 (47%), Gaps = 5/104 (4%) Frame = +1 Query: 271 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG-VPN 447 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++ Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQT 757 Query: 448 GFRQNVGLHL----ASHCAHK*PTAIRRGDGPIALVLAPTRELA 567 G + L + A ++ P A+ +APTRELA Sbjct: 758 GSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELA 801 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 443 QTGSGKTLAYILPAIVHINNQPL 511 QTGSGKT A++LP + + N L Sbjct: 756 QTGSGKTAAFLLPVMTSMMNAGL 778 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +1 Query: 271 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 435 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++ Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVM 175 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = +1 Query: 274 VTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVPNGF 453 + V G P++ + + + +K Y++PTPIQAQ P+ MSG++++ + Sbjct: 93 IHVRGKNAPKPVKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTP 152 Query: 454 RQNVGLHLASHC 489 + + + + C Sbjct: 153 TRELAIQIHREC 164 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 146 QNMRRPDWDSVSLQPFNKNFYDPHPTVLKRSPYEVEGIEIN 268 + ++ D +V QPF K+FY P + K +P E + ++ Sbjct: 49 EELQPVDHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLS 89 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 39.1 bits (87), Expect = 0.003 Identities = 26/87 (29%), Positives = 39/87 (44%) Frame = +1 Query: 307 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVPNGFRQNVGLHLASH 486 ++ F + G+ G+ PT IQ QG P+A+SG++++G L Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPI 108 Query: 487 CAHK*PTAIRRGDGPIALVLAPTRELA 567 DG ALV++PTRELA Sbjct: 109 IETLWRQKWTSMDGLGALVISPTRELA 135 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +2 Query: 437 AYQTGSGKTLAYILPAI 487 A +TGSGKTLA+++P I Sbjct: 93 AAKTGSGKTLAFLIPII 109 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 33.9 bits (74), Expect = 0.11 Identities = 23/84 (27%), Positives = 39/84 (46%) Frame = +1 Query: 316 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVPNGFRQNVGLHLASHCAH 495 FE+ + G+ G+ +P+PIQ + P+A++G++++ +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 496 K*PTAIRRGDGPIALVLAPTRELA 567 T + ALVL PTRELA Sbjct: 109 TDTTK----NCIQALVLVPTRELA 128 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 33.9 bits (74), Expect = 0.11 Identities = 23/84 (27%), Positives = 39/84 (46%) Frame = +1 Query: 316 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVPNGFRQNVGLHLASHCAH 495 FE+ + G+ G+ +P+PIQ + P+A++G++++ +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 496 K*PTAIRRGDGPIALVLAPTRELA 567 T + ALVL PTRELA Sbjct: 109 TDTTK----NCIQALVLVPTRELA 128 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 32.7 bits (71), Expect = 0.26 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 3/76 (3%) Frame = +1 Query: 349 QGVKTMGYKEPTPIQAQGWPIAMSGKNL---VGVPNGFRQNVGLHLASHCAHK*PTAIRR 519 + V +G+ PTPIQA P+A+ GK++ G L + ++ PT + Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYR-PT---Q 78 Query: 520 GDGPIALVLAPTRELA 567 LV+ PTRELA Sbjct: 79 SPAIRVLVITPTRELA 94 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.3 bits (70), Expect = 0.34 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 307 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 435 I FE+ + + + V GYK+PTP+Q PI ++L+ Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLM 916 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 31.1 bits (67), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +1 Query: 265 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 420 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 292 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 405 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 437 AYQTGSGKTLAYILPAIVHINNQPLFGEVMVRL 535 A QTGSGKTLAY+ P + + ++ RL Sbjct: 421 AAQTGSGKTLAYLAPLVHRLREDEERHGILARL 453 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 2/75 (2%) Frame = +1 Query: 349 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVG-VPNGFRQNVG-LHLASHCAHK*PTAIRRG 522 QG+K MG+ T IQ + + G++L+G G + + L +K R G Sbjct: 585 QGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNG 644 Query: 523 DGPIALVLAPTRELA 567 G ++++PTREL+ Sbjct: 645 TG--VIIISPTRELS 657 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +2 Query: 437 AYQTGSGKTLAYILPAI 487 A +TGSGKTLA+++P + Sbjct: 615 AAKTGSGKTLAFLVPVV 631 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 437 AYQTGSGKTLAYILPAIVHI 496 A +TGSGKTLA+ +P I HI Sbjct: 174 AAETGSGKTLAFGIPIIQHI 193 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 122 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 12 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 514 RRGDGPIALVLAPTRELA 567 +RG P LV+APTRELA Sbjct: 143 KRGRAPKVLVMAPTRELA 160 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 449 GSGKTLAYILPAIVHINNQPLFGEV 523 GSGK LAY+LP I I ++ E+ Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQEL 258 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,962,172 Number of Sequences: 59808 Number of extensions: 429883 Number of successful extensions: 1167 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1159 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -