BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20322 (642 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 50 5e-08 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.0 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 23 8.2 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 8.2 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 50.4 bits (115), Expect = 5e-08 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 3/102 (2%) Frame = +1 Query: 271 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG---V 441 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G++L+ Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 442 PNGFRQNVGLHLASHCAHK*PTAIRRGDGPIALVLAPTRELA 567 +G L + H K + R P +++APTRELA Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELA 262 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 2.0 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -2 Query: 146 ALQRILFSHQSLQILQ------IYCHRCQTETNYRRIC 51 A +R+ SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +3 Query: 342 CATRCKDNGLQRTDAHSSSRLADSYVWKEFSWRTKRVPAKRWPT 473 C T K + A S A WR K +P RW T Sbjct: 211 CGTGWKYRSISSLHAPPSHPGAHRAAEPRLDWRIKILPLPRWNT 254 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 23.0 bits (47), Expect = 8.2 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = +3 Query: 438 RTKRVPAKRWPT 473 R +R+PA++WPT Sbjct: 203 RQQRLPAQQWPT 214 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,734 Number of Sequences: 2352 Number of extensions: 14045 Number of successful extensions: 29 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -