BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20321 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.4 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 5.4 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 22 5.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.4 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 22 5.4 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 22 5.4 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 5.4 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 22 5.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 5.4 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 22 5.4 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 7.2 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.5 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 9.5 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 9.5 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 9.5 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.5 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = -2 Query: 626 CNTLCDCFNISECSLTCTCAQKPDCLVD 543 C LC C + C TC C D Sbjct: 743 CFALCHCCDFDACDCEMTCPAGCKCYND 770 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +2 Query: 239 YAKYLLIQLAGMHTSVSVKPSAQSWSAL 322 + YL+I +G+ V + P W +L Sbjct: 291 WTPYLVINFSGIFNLVKISPLFTIWGSL 318 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 22.2 bits (45), Expect = 5.4 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 127 FTTSRRHS*NQAFRQMELLRCASL*YVSAGLHFR*REVRKIFTHSAGRYAHKRFRKAQ 300 FTT + S + FR+ + L A S+ LH +V+ F + R KR ++A+ Sbjct: 16 FTTQQLLSLEKKFREKQYLTIAERAEFSSSLHLTETQVKIWFQNR--RAKAKRLQEAE 71 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 5.4 Identities = 23/94 (24%), Positives = 39/94 (41%) Frame = +2 Query: 41 SNRKVPIMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDY 220 S+R V + AE+ V + S +++T+ A + + + + + LQD Sbjct: 345 SDRVVALEAEKKNLSKVIDQHSQLIDTLENVLAIVDRLMDETNQLTLQETADAFKDLQD- 403 Query: 221 ISVKEKYAKYLLIQLAGMHTSVSVKPSAQSWSAL 322 E+Y Y L +LA VK SW+ L Sbjct: 404 -KYYEEYKMYELGELASSFVGPKVKDCLISWNPL 436 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 280 KRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 381 +R R + I+ L+N + + NN KKL I Sbjct: 72 ERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 280 KRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 381 +R R + I+ L+N + + NN KKL I Sbjct: 72 ERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 280 KRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 381 +R R + I+ L+N + + NN KKL I Sbjct: 72 ERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 280 KRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 381 +R R + I+ L+N + + NN KKL I Sbjct: 72 ERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 280 KRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 381 +R R + I+ L+N + + NN KKL I Sbjct: 305 ERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 338 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +2 Query: 239 YAKYLLIQLAGMHTSVSVKPSAQSWSAL 322 + YL+I +G+ V + P W +L Sbjct: 41 WTPYLVINFSGIFNLVKISPLFTIWGSL 68 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 209 ETYQRLAHRSNSICRKA*FQECRRLVVKTWFP 114 + Y+RL H N I ++ F RL T+ P Sbjct: 240 QVYRRLVHAVNEIEKRLLFSHNDRLGFLTFCP 271 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 379 IVKHAFEIIHLLTGENPLQVLVTAII 456 +++HAFEI +L P+ +++ I Sbjct: 217 LIEHAFEISTMLFFVLPMTIIIVLYI 242 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 9.5 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -2 Query: 347 RPCIIREFVRRSTIGHWAL 291 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 9.5 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -2 Query: 347 RPCIIREFVRRSTIGHWAL 291 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 9.5 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -2 Query: 347 RPCIIREFVRRSTIGHWAL 291 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 329 EFVRRSTIGHWALRKRLCAYLPAE 258 EF R T AL K+LC PAE Sbjct: 585 EFPRSITRNATALIKKLCRDNPAE 608 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,970 Number of Sequences: 438 Number of extensions: 4104 Number of successful extensions: 21 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -