BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20314 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 5.7 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 7.6 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 7.6 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 44 GVFLKQLNSKITRFNVFISTSHLFV*FYREVSP 142 G +L ++N +I RF+ SHL + + V+P Sbjct: 112 GDYLVRINHRIDRFSKIYCCSHLCLAIFYWVAP 144 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 232 CFSVMIFFSNFFKL 191 CF+V+ F S+FF L Sbjct: 52 CFNVLTFISSFFSL 65 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -1 Query: 389 NVLFLLIFINIAWSCFIIIIVLILNYYCL 303 NV+F + A CF+++ I YY + Sbjct: 555 NVIFYFGTASFAIPCFVVLTFFIYYYYAV 583 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,106 Number of Sequences: 2352 Number of extensions: 11055 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -