BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20314 (746 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC027734-1|AAH27734.2| 176|Homo sapiens vitamin K epoxide reduc... 30 7.7 AY423045-1|AAR82915.1| 176|Homo sapiens VKORC1-like protein 1 p... 30 7.7 >BC027734-1|AAH27734.2| 176|Homo sapiens vitamin K epoxide reductase complex, subunit 1-like 1 protein. Length = 176 Score = 30.3 bits (65), Expect = 7.7 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = -1 Query: 413 LMSVKGTVNVLFLLIFINIAWSCFIIIIVLILNYYCLII 297 +MSV G++ + ++L F+ + C I I+ +LN+ LII Sbjct: 118 IMSVVGSLYLAYILYFV-LKEFCIICIVTYVLNFLLLII 155 >AY423045-1|AAR82915.1| 176|Homo sapiens VKORC1-like protein 1 protein. Length = 176 Score = 30.3 bits (65), Expect = 7.7 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = -1 Query: 413 LMSVKGTVNVLFLLIFINIAWSCFIIIIVLILNYYCLII 297 +MSV G++ + ++L F+ + C I I+ +LN+ LII Sbjct: 118 IMSVVGSLYLAYILYFV-LKEFCIICIVTYVLNFLLLII 155 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,906,164 Number of Sequences: 237096 Number of extensions: 1632541 Number of successful extensions: 2444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2444 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8959138240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -