BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20306 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 24 3.9 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 24 3.9 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 5.2 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 24 5.2 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 23 9.0 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.0 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.2 bits (50), Expect = 3.9 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = -2 Query: 443 DRSLVLFSTI*NGLEVQHLDQTNQIYHQIQDRYMQHDHYHLVFSQQNNVSYQLQLPV 273 D +F + GL L TN++ + R + HLV S+ N+V Y L++ V Sbjct: 399 DDRFEIFGEVAMGLACFRLKGTNELSEALLKRINGRGNIHLVPSKVNDV-YFLRMAV 454 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.2 bits (50), Expect = 3.9 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = -2 Query: 443 DRSLVLFSTI*NGLEVQHLDQTNQIYHQIQDRYMQHDHYHLVFSQQNNVSYQLQLPV 273 D +F + GL L TN++ + R + HLV S+ N+V Y L++ V Sbjct: 430 DDRFEIFGEVAMGLACFRLKGTNELSEALLKRINGRGNIHLVPSKVNDV-YFLRMAV 485 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/48 (22%), Positives = 21/48 (43%) Frame = -2 Query: 473 IQDPIVPVVFDRSLVLFSTI*NGLEVQHLDQTNQIYHQIQDRYMQHDH 330 + DP + + S L + N +++Q Q Q++H + Q H Sbjct: 39 LHDPASSIARNASFTLGLGLANVIQLQQQQQQQQLHHSPHQYHQQVQH 86 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 88 FLKYHPEHLTEDIGQQIGTCKSHNGQVA 171 F+ PE+L E + G+ K+H+G A Sbjct: 29 FMDLPPEYLPERYQRIAGSIKTHHGSTA 56 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.0 bits (47), Expect = 9.0 Identities = 16/72 (22%), Positives = 25/72 (34%) Frame = -3 Query: 235 NSPLVLSSNFMTNSFPFDTNLMRPVHCGSCKFQSAALYPLLDVLGGILKTNIRSSLK*HF 56 N PLV+ D V S F + + P ++ + + Sbjct: 406 NEPLVVRDVSQRTFISVDEQGTTAVSAASLAFVALSAAPPPPIINFAVNEPFLMMIVDKI 465 Query: 55 HKYPLFIKNNVN 20 H+YPLF+ VN Sbjct: 466 HEYPLFVGKIVN 477 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 395 QHLDQTNQIYHQIQDRYMQHDHYH 324 Q DQT+ Q + QH H+H Sbjct: 634 QKADQTDHHQSQQPQQQQQHQHHH 657 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,571 Number of Sequences: 2352 Number of extensions: 12741 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -