BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20306 (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03900.1 68414.m00374 expressed protein 77 8e-15 At3g58600.1 68416.m06531 expressed protein hypothetical protein ... 71 7e-13 At2g41490.1 68415.m05125 UDP-GlcNAc:dolichol phosphate N-acetylg... 31 0.72 At1g50500.1 68414.m05664 membrane trafficking VPS53 family prote... 28 5.0 At1g79580.3 68414.m09279 no apical meristem (NAM) family protein... 28 6.7 At1g79580.2 68414.m09278 no apical meristem (NAM) family protein... 28 6.7 At1g79580.1 68414.m09277 no apical meristem (NAM) family protein... 28 6.7 At2g31930.1 68415.m03900 expressed protein 27 8.8 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 8.8 >At1g03900.1 68414.m00374 expressed protein Length = 272 Score = 77.4 bits (182), Expect = 8e-15 Identities = 40/89 (44%), Positives = 62/89 (69%), Gaps = 10/89 (11%) Frame = +2 Query: 272 ALEAVTDSSRYFVVKIQDDNGRAAYIGLGFGDRSDSFDLNVALQDHFKWLK--KEQESDQ 445 ++E DSSRYFV++I D G+ A+IGLGF +R+++FD NVAL DH K+++ KE+E+ + Sbjct: 87 SVEPSLDSSRYFVLRIDDGRGKYAFIGLGFAERNEAFDFNVALSDHEKYVRREKEKETGE 146 Query: 446 TPQ--GQLDL------GFKDGETIKINMK 508 T + +D+ K+GETI+IN+K Sbjct: 147 TSESDNHIDIHPAVNHRLKEGETIRINVK 175 Score = 62.9 bits (146), Expect = 2e-10 Identities = 25/56 (44%), Positives = 39/56 (69%) Frame = +3 Query: 81 IFVFKIPPRTSNRGYRAADWNLQEPQWTGRMRLVSKGNELVMKLEDKTSGELFAKC 248 + V+KIPPRT++ GY+ +W + W+GR+R+VS + ++LED SG+LFA C Sbjct: 22 VSVYKIPPRTTSGGYKCGEWLQSDKIWSGRLRVVSCKDRCEIRLEDSNSGDLFAAC 77 >At3g58600.1 68416.m06531 expressed protein hypothetical protein F21M11.17 - Arabidopsis thaliana, EMBL:AC003027 Length = 302 Score = 70.9 bits (166), Expect = 7e-13 Identities = 35/86 (40%), Positives = 56/86 (65%), Gaps = 8/86 (9%) Frame = +2 Query: 275 LEAVTDSSRYFVVKIQ---DDNGRAAYIGLGFGDRSDSFDLNVALQDHFKWLKKEQESDQ 445 +EAV DSSRYFV++++ D R A+IGLGF +R++++D AL DH K+L K++ +++ Sbjct: 107 VEAVIDSSRYFVLRVEEKIDGRVRHAFIGLGFRERTEAYDFQAALHDHMKYLNKKKTAEE 166 Query: 446 TPQ-----GQLDLGFKDGETIKINMK 508 Q +D K+GETI + +K Sbjct: 167 MEQHYQNTSSVDYSLKEGETIVLQLK 192 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/70 (41%), Positives = 45/70 (64%) Frame = +3 Query: 66 FSEERIFVFKIPPRTSNRGYRAADWNLQEPQWTGRMRLVSKGNELVMKLEDKTSGELFAK 245 F +V+ IPPR + YRA +W++ + W G +++VSKG E ++KL DKT+GEL+A+ Sbjct: 37 FQVPECYVYLIPPRKTAASYRADEWDVNKWAWEGALKVVSKGEECIIKLVDKTTGELYAQ 96 Query: 246 CPIINIQELH 275 + ELH Sbjct: 97 A-FLREGELH 105 >At2g41490.1 68415.m05125 UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate transferase identical to GI:5804772 Length = 431 Score = 31.1 bits (67), Expect = 0.72 Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 346 ICSTTIIILYFHNKIT*AISYSFQCNSWIFIIGHFANNSPLVLSSNFM--TNSFPFDTN 176 +CS + +L FH K+ + S N+ + ++G F + +++ ++ N F FD N Sbjct: 59 LCSLYLYLLCFHYKVDNELKRSILINAGLSLVGFFVTLKMIPVTARYVLRRNMFGFDIN 117 >At1g50500.1 68414.m05664 membrane trafficking VPS53 family protein contains Pfam domain PF04100: Vps53-like, N-terminal Length = 798 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = -2 Query: 473 IQDPIVPVVFDRSLVLFSTI*NGLEVQHLDQTNQIYHQIQDRYMQHDHYHLVFSQQNNVS 294 +++ +V R L + I G E+ LD+T + Y I+ R ++ +F +V Sbjct: 213 VREELVNNFCSRELTSYEQIFEGAELAKLDKTERRYAWIKRRIRTNEEIWKIFPASWHVP 272 Query: 293 YQL 285 Y+L Sbjct: 273 YRL 275 >At1g79580.3 68414.m09279 no apical meristem (NAM) family protein similar to OsNAC7 protein (GI:6730944) [Oryza sativa]; contains weak hit to Pfam PF02365 : No apical meristem (NAM) protein Length = 371 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 395 QHLDQTNQIYHQIQDRYMQHDHYHLVFSQQNNVS 294 Q +Q + +HQ HDH+H + S NN S Sbjct: 175 QEQEQDHHHHHQYISTNNDHDHHHHIDSNSNNHS 208 >At1g79580.2 68414.m09278 no apical meristem (NAM) family protein similar to OsNAC7 protein (GI:6730944) [Oryza sativa]; contains weak hit to Pfam PF02365 : No apical meristem (NAM) protein Length = 371 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 395 QHLDQTNQIYHQIQDRYMQHDHYHLVFSQQNNVS 294 Q +Q + +HQ HDH+H + S NN S Sbjct: 175 QEQEQDHHHHHQYISTNNDHDHHHHIDSNSNNHS 208 >At1g79580.1 68414.m09277 no apical meristem (NAM) family protein similar to OsNAC7 protein (GI:6730944) [Oryza sativa]; contains weak hit to Pfam PF02365 : No apical meristem (NAM) protein Length = 371 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 395 QHLDQTNQIYHQIQDRYMQHDHYHLVFSQQNNVS 294 Q +Q + +HQ HDH+H + S NN S Sbjct: 175 QEQEQDHHHHHQYISTNNDHDHHHHIDSNSNNHS 208 >At2g31930.1 68415.m03900 expressed protein Length = 143 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 422 KKEQESDQTPQGQLDLGFKDGETIKINMKLLKK 520 K E+D + LD F+DGE IK M+L+ K Sbjct: 72 KLNGEADVNNKSSLDQHFEDGEGIKPTMQLVVK 104 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.5 bits (58), Expect = 8.8 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Frame = -3 Query: 181 TNLMRPVHCGSCKF-QSAALYPLLDV----LGGI-LKTNIRSSLK*HFHKYPLFIK 32 T+L HC S +A P LD+ L G+ LK RS + H HKYP FI+ Sbjct: 540 TSLYNSHHCPSLYICMLSAADPKLDIREIALEGLFLKEEGRSIVSNHDHKYPKFIE 595 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,536,408 Number of Sequences: 28952 Number of extensions: 274610 Number of successful extensions: 799 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -