BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20303 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 52 8e-09 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 2.3 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 3.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 5.4 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 9.4 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 51.6 bits (118), Expect = 8e-09 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 9/93 (9%) Frame = +1 Query: 256 TGKTATFSISIL-----QQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAK 408 +GKTA F++ I+ + +D + E Q +I++PTREL QI + ++ + K Sbjct: 244 SGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNSILK 303 Query: 409 CHACIGGTNVREDIRQLEXGVHVVVGTPGRVYD 507 GGT+V +L G H++V TPGR+ D Sbjct: 304 TVVAYGGTSVMHQRGKLSAGCHILVATPGRLLD 336 Score = 36.7 bits (81), Expect = 2e-04 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Frame = +3 Query: 534 NTIKLFVLDEADEMLSRGFKDQI-----HDVFKMLSADVQVILLSATMPDDVLEVSR 689 ++++ VLDEAD ML GF I H+ L + Q ++ SAT PD+V ++R Sbjct: 346 SSVQFLVLDEADRMLDMGFLPSIEKMVDHETMVPL-GERQTLMFSATFPDEVQHLAR 401 Score = 26.6 bits (56), Expect = 0.25 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = +2 Query: 173 FEKPSAIQQRAIMPCIQGRDVIAQAQS 253 ++KP+ +Q+ A+ + GRD++A AQ+ Sbjct: 216 YKKPTPVQKHALPIIMNGRDLMACAQT 242 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 439 GHWCHQCKHGI*HSS 395 G CH+CK+GI SS Sbjct: 40 GDSCHKCKYGIAMSS 54 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 537 CWHEAHDELSIIYTTWSAHHXMNTXL 460 C + AH++LS ++ W N+ L Sbjct: 341 CSYMAHEKLSYAFSVWRMEDDWNSNL 366 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 Query: 417 LHWWHQCP 440 LH WH CP Sbjct: 470 LHHWHHCP 477 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 593 LETSGQHFISFIKNKKFDGVGM 528 L+ H I+ I +K F GVG+ Sbjct: 120 LQVFRDHLINQIPDKSFPGVGV 141 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 62 TSGNGHWDT*HRLGSSCRNL 121 + G HWD+ R ++ RN+ Sbjct: 264 SGGTNHWDSGRRKSAAQRNV 283 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,901 Number of Sequences: 438 Number of extensions: 5057 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -