BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20299 (609 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46933-4|CAA87037.1| 452|Caenorhabditis elegans Hypothetical pr... 29 3.4 AC024808-3|AAK29925.1| 183|Caenorhabditis elegans Hypothetical ... 28 4.5 >Z46933-4|CAA87037.1| 452|Caenorhabditis elegans Hypothetical protein F34H10.4 protein. Length = 452 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = -3 Query: 385 ITSVIRTNLITKINFYNIMHFKNKCFLYITVFYLFIY*MAYSWTESILNML 233 I S + +T I FYNI N L +VF+L +Y +YS ++IL+ L Sbjct: 354 ILSSLNFQYVTPIVFYNIFSVSNSIQLCSSVFFLKVY--SYS-LKTILSAL 401 >AC024808-3|AAK29925.1| 183|Caenorhabditis elegans Hypothetical protein Y53G8AM.6 protein. Length = 183 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 506 CLLTVISGIFNCISHANYRVIFNIDNIMS 592 C+ ++S + N HA+Y +FN +N++S Sbjct: 56 CVRILLSLVHNVFVHASYYNVFNFENLVS 84 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,681,770 Number of Sequences: 27780 Number of extensions: 210937 Number of successful extensions: 375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -