BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20297 (549 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 25 0.44 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 23 1.8 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 23 1.8 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.4 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 25.0 bits (52), Expect = 0.44 Identities = 11/41 (26%), Positives = 16/41 (39%) Frame = +1 Query: 337 HGGGHSAGRHEQAXVLDKEMKVNWATSPGNQPKTDTSNHHH 459 H G AG H + ++ S G P + +HHH Sbjct: 16 HQSGSVAGHHHEQSAAAAAAYRSFPLSLGMSPYASSQHHHH 56 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 539 VRYLTKWSEGPRSMFVS 489 +RY KW+EGP S+ VS Sbjct: 13 IRY--KWNEGPNSVGVS 27 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 539 VRYLTKWSEGPRSMFVS 489 +RY KW+EGP S+ VS Sbjct: 195 IRY--KWNEGPNSVGVS 209 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -3 Query: 256 TNNVHRKTSVTLGSKLPT*RVFGWLSSP 173 +N++ S++ G +LP FG ++SP Sbjct: 37 SNSITVPLSISTGQRLPANFSFGQVNSP 64 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 Query: 386 SRTXACSWRPALWPPP 339 S T W+P W PP Sbjct: 1362 STTNYPEWQPTEWHPP 1377 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 424 NQPKTDTSNHHH 459 +QP TD S+ HH Sbjct: 125 SQPPTDNSHVHH 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,955 Number of Sequences: 336 Number of extensions: 2697 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -