BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20297 (549 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 5.0 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 8.8 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.4 bits (48), Expect = 5.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 199 RVFGWLSSPILAYRNLSITFLTSMNTNININRLTTCY 89 R F L +L +R S+T L + +NI +L CY Sbjct: 72 RQFRDLGGQLLVFRGDSVTVLRRLFEELNIKKL--CY 106 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 424 NQPKTDTSNHHHIFVG 471 N P +NHH +FVG Sbjct: 2 NIPARHGANHHELFVG 17 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,297 Number of Sequences: 2352 Number of extensions: 11853 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -