BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20290 (803 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 6e-19 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 83 3e-16 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 79 6e-15 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 73 4e-13 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 71 8e-13 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 66 3e-11 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 66 3e-11 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 62 4e-10 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 62 4e-10 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 60 2e-09 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 50 2e-06 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 40 0.003 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 38 0.007 SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) 34 0.12 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 33 0.27 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 32 0.47 SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.47 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 32 0.47 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.63 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 32 0.63 SB_4393| Best HMM Match : 7tm_1 (HMM E-Value=6.40393e-43) 28 1.1 SB_4394| Best HMM Match : 7tm_1 (HMM E-Value=1.69978e-42) 28 1.1 SB_14979| Best HMM Match : 7tm_1 (HMM E-Value=8.8e-32) 28 1.1 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 31 1.4 SB_1761| Best HMM Match : ERF (HMM E-Value=6.8) 30 1.9 SB_42440| Best HMM Match : RnaseH (HMM E-Value=0.9) 30 1.9 SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 30 2.5 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 30 2.5 SB_21574| Best HMM Match : T-box (HMM E-Value=0) 30 2.5 SB_20574| Best HMM Match : Extensin_2 (HMM E-Value=0.25) 29 3.3 SB_2799| Best HMM Match : rve (HMM E-Value=7.8e-26) 29 3.3 SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) 29 5.8 SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) 28 7.7 SB_53479| Best HMM Match : Zot (HMM E-Value=1.1) 28 7.7 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 28 7.7 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 91.9 bits (218), Expect = 6e-19 Identities = 42/66 (63%), Positives = 51/66 (77%), Gaps = 5/66 (7%) Frame = +2 Query: 524 DATQT-----KKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLN 688 DATQ KK++ H+KRPMNAFMVWSQIERRK+ E+ PDMHNAEISK LG+ WK L+ Sbjct: 28 DATQATHESKKKSDMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLS 87 Query: 689 DEERHP 706 + E+ P Sbjct: 88 ESEKRP 93 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 83.0 bits (196), Expect = 3e-16 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = +2 Query: 542 KNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 K H+KRPMNAFMVW+Q RRK+ +Q P +HNAE+SK LG++WK LND E+ P Sbjct: 58 KTQKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDSEKKP 112 Score = 31.5 bits (68), Expect = 0.83 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Frame = +1 Query: 553 QPHQETDERVHGLVADRTQKNMRTNTGHAQRRDIKKSRTRL----EDSERRRAPPFIDEA 720 +PH + + A ++ + H ++ K+ +L DSE++ PFI+EA Sbjct: 61 KPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDSEKK---PFIEEA 117 Query: 721 ERLRQLHMRD 750 ERLR H R+ Sbjct: 118 ERLRIKHKRE 127 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 79.0 bits (186), Expect = 4e-15 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +2 Query: 536 TKKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 TK N+ + +KRPMNAFMVWS+ RRK+ + P MHN+EISK LG WK L+++E+ P Sbjct: 781 TKANSADRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQEKRP 837 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +1 Query: 673 LEDSERRRAPPFIDEAERLRQLHMRD 750 L + E+R P+IDEA RLR +HM++ Sbjct: 830 LSEQEKR---PYIDEARRLRAVHMKE 852 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 78.6 bits (185), Expect = 6e-15 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 557 HIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 H+KRPMNAFMVWS+ ERRKI ++ P MHN+EISK LG WK L D+++ P Sbjct: 326 HVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKP 375 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 78.6 bits (185), Expect = 6e-15 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 557 HIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 H+KRPMNAFMVWS+ ERRKI ++ P MHN+EISK LG WK L D+++ P Sbjct: 9 HVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKP 58 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 76.6 bits (180), Expect = 2e-14 Identities = 30/60 (50%), Positives = 42/60 (70%) Frame = +2 Query: 527 ATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 A K + IKRPMNAFMVW+Q+ERR++ + P++HNAE+SK LG W+ LN ++ P Sbjct: 355 ARTEKDDETERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRALNSTQKRP 414 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 703 PFIDEAERLRQLHMRD 750 PF+DEAERLR HM+D Sbjct: 414 PFVDEAERLRLQHMQD 429 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 75.4 bits (177), Expect = 5e-14 Identities = 33/64 (51%), Positives = 47/64 (73%) Frame = +2 Query: 515 PYTDATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDE 694 PY++ Q K +P +KRPMN+FMVW+Q RRK+ EQ P +HNAE+SK LG++W+ L+ Sbjct: 98 PYSEV-QLPKKDPK-VKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRMLSAA 155 Query: 695 ERHP 706 E+ P Sbjct: 156 EKQP 159 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 72.5 bits (170), Expect = 4e-13 Identities = 26/55 (47%), Positives = 41/55 (74%) Frame = +2 Query: 542 KNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 + + +H+KRPMN+FM+W+++ RRK E+ P +HNAEISK LG+ W L +++ P Sbjct: 88 EEDDSHVKRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRP 142 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 71.3 bits (167), Expect = 8e-13 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +2 Query: 542 KNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 + + HIKRPMNAFMVWS+ ERRK+ + P+M N EISK LG W L++EE+ P Sbjct: 3 ETDDQHIKRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEKRP 57 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 69.7 bits (163), Expect = 3e-12 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +2 Query: 554 NHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 NH+KRPMNAFMVWS+ RR ++ P MHN+EISK LG WK + DE + P Sbjct: 7 NHVKRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDELKQP 57 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 69.7 bits (163), Expect = 3e-12 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +2 Query: 554 NHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 +HIKRPMNA+MVWS+ ERR+I E+ P M N+EISK LG W +L +E+ P Sbjct: 6 DHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSLTLDEKQP 56 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/16 (56%), Positives = 15/16 (93%) Frame = +1 Query: 703 PFIDEAERLRQLHMRD 750 P+++EA+RLR+LH +D Sbjct: 56 PYVEEAKRLRELHKKD 71 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 66.1 bits (154), Expect = 3e-11 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 554 NHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 +HIKRPMNAFM+WS +RR++ + P +HN++ISK LG W+ L EE+ Sbjct: 5 SHIKRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEK 53 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 66.1 bits (154), Expect = 3e-11 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 554 NHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 +HIKRPMNAFM+WS +RR++ + P +HN++ISK LG W+ L EE+ Sbjct: 5 SHIKRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEK 53 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 64.1 bits (149), Expect = 1e-10 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +2 Query: 557 HIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 H+KRPMN FMVWS+ +R +I ++ P ++NA +SK LG WK L+ EE+ P Sbjct: 7 HVKRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEP 56 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 63.7 bits (148), Expect = 2e-10 Identities = 25/63 (39%), Positives = 41/63 (65%) Frame = +2 Query: 518 YTDATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEE 697 +T + ++ N +KRPMNAFM+W+++ R I ++ P +NAEIS LG +W L+ E+ Sbjct: 87 HTVQAEMRQENNAKVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQ 146 Query: 698 RHP 706 + P Sbjct: 147 QKP 149 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = +2 Query: 527 ATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 A K++ IKRP+NAF++WS+ RR I + P MHN +IS+ LG W+ L +EE+ Sbjct: 8 AADDLKSSSEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEK 65 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 62.5 bits (145), Expect = 4e-10 Identities = 28/60 (46%), Positives = 36/60 (60%) Frame = +2 Query: 542 KNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHPSSMKP 721 K H+K PMNAFMV S+ +R+ P MHN+E SK+LG WK L EE+ P +P Sbjct: 3 KQEDGHVKSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKMLTSEEKDPFIAEP 62 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 60.5 bits (140), Expect = 2e-09 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = +2 Query: 554 NHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERHP 706 +H+KRP+N+FMVW++ +RR + + P M NAEISK LG W+ + + E+ P Sbjct: 8 DHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPESEKLP 58 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/54 (38%), Positives = 34/54 (62%) Frame = +2 Query: 539 KKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 KK +PN KR M+A+M+W R++I ++ P + E+SK G +WK L D+ + Sbjct: 535 KKKDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSK 588 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 49.2 bits (112), Expect = 4e-06 Identities = 21/52 (40%), Positives = 33/52 (63%) Frame = +2 Query: 545 NNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 ++ +HI+RPMNAFM++S+ R + ++ P N +SK LG W L EE+ Sbjct: 511 DSKDHIRRPMNAFMIFSKRHRALVHQKHPHQDNRTVSKILGEWWYALGPEEK 562 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 4/64 (6%) Frame = +2 Query: 521 TDATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQTPD----MHNAEISKNLGRVWKTLN 688 + A Q K+ +PN K+P NAF ++ Q +R + E D M + E++K+L + W L Sbjct: 42 SSAKQDKEKDPNAPKKPANAFFMFCQQQRTVMQEDHKDATAVMGHHELTKSLAKEWNNLL 101 Query: 689 DEER 700 +E+ Sbjct: 102 PDEK 105 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/51 (27%), Positives = 30/51 (58%) Frame = +2 Query: 542 KNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDE 694 KN +++ P++AF +W+ R+ + PD+ ++ K L R WK ++++ Sbjct: 221 KNKYPNVEPPLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEK 271 >SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) Length = 1311 Score = 34.3 bits (75), Expect = 0.12 Identities = 10/22 (45%), Positives = 19/22 (86%) Frame = +2 Query: 542 KNNPNHIKRPMNAFMVWSQIER 607 + + +H+KRPMN+FM+W+++ R Sbjct: 1289 EEDDSHVKRPMNSFMIWAKVMR 1310 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 551 PNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTL 685 P KRP AF + Q K+ E+ P + +AEI K+L W L Sbjct: 303 PKKHKRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANL 347 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = +2 Query: 551 PNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 P ++P+ +M +S+ ++ Q PD +I K +G++W+ L+D E+ Sbjct: 25 PKPPEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDDAEK 74 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 575 NAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 N F +W + R +I E+ PD+ + ++ K + WK L+ E+ Sbjct: 41 NGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEK 82 >SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1387 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/48 (29%), Positives = 28/48 (58%) Frame = +1 Query: 88 AVLTELRSGPNAKIMTFGSYACEEVSSSFHVHEGKVRIVSRYWEIFGN 231 AVL + + G +++ +GS + + ++H+H GK+ I++ W I N Sbjct: 452 AVLYQRQKG-TLRVIGYGSRSLTQAERNYHLHSGKLEILALKWAIREN 498 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +1 Query: 88 AVLTELRSGPNAKIMTFGSYACEEVSSSFHVHEGKVRIVSRYWEI 222 AVL + + G +++ +GS + + ++H+H GK+ ++ W I Sbjct: 516 AVLYQRQKG-TLRVIGYGSRSLTQAERNYHLHSGKLEFLALKWAI 559 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 575 NAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 N F +W + R +I E+ PD+ + ++ K + WK L+ E+ Sbjct: 334 NGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEK 375 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +2 Query: 533 QTKKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 + K +PN K +A+ + Q +R K+ + A+ SK WK +++EE+ Sbjct: 3 KVSKKDPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEK 58 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/45 (26%), Positives = 28/45 (62%) Frame = +2 Query: 566 RPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEER 700 +P++A+ ++ + + I Q P EI+K +G++W+ L +E++ Sbjct: 927 KPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQK 971 >SB_4393| Best HMM Match : 7tm_1 (HMM E-Value=6.40393e-43) Length = 521 Score = 28.3 bits (60), Expect(2) = 1.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 351 HFSTSDLFEFQILKFICSFTAVRVVP 274 +F+ D F FQ KF+C FT R +P Sbjct: 162 YFAGGDKFIFQPAKFLCFFTLKRPLP 187 Score = 21.4 bits (43), Expect(2) = 1.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 465 WMLASKTSHPTLAG 424 WMLAS +S P AG Sbjct: 152 WMLASVSSVPYFAG 165 >SB_4394| Best HMM Match : 7tm_1 (HMM E-Value=1.69978e-42) Length = 331 Score = 28.3 bits (60), Expect(2) = 1.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 351 HFSTSDLFEFQILKFICSFTAVRVVP 274 +F+ D F FQ KF+C FT R +P Sbjct: 162 YFAGGDKFIFQPAKFLCFFTLKRPLP 187 Score = 21.4 bits (43), Expect(2) = 1.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 465 WMLASKTSHPTLAG 424 WMLAS +S P AG Sbjct: 152 WMLASVSSVPYFAG 165 >SB_14979| Best HMM Match : 7tm_1 (HMM E-Value=8.8e-32) Length = 271 Score = 28.3 bits (60), Expect(2) = 1.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 351 HFSTSDLFEFQILKFICSFTAVRVVP 274 +F+ D F FQ KF+C FT R +P Sbjct: 162 YFAGGDKFIFQPAKFLCFFTLKRPLP 187 Score = 21.4 bits (43), Expect(2) = 1.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 465 WMLASKTSHPTLAG 424 WMLAS +S P AG Sbjct: 152 WMLASVSSVPYFAG 165 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = +2 Query: 560 IKRPMNAFMVWSQIERRKICEQ-----TPDMHNAEISKNLGRVWKTLNDEERHPSSMKPN 724 +KR +A++ ++ R K+ + TP E++K G WK LNDE++ P K Sbjct: 496 VKRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPYVAKAE 555 Query: 725 A 727 A Sbjct: 556 A 556 >SB_1761| Best HMM Match : ERF (HMM E-Value=6.8) Length = 299 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +1 Query: 88 AVLTELRSGPNAKIMTFGSYACEEVSSSFHVHEGKVRIVSRYWEI 222 AVL + + G +++ +GS + + ++H+H GK+ ++ W I Sbjct: 193 AVLYQRQKG-TLRVIGYGSRSLTQAERNYHLHSGKLEFLALKWAI 236 >SB_42440| Best HMM Match : RnaseH (HMM E-Value=0.9) Length = 348 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +1 Query: 88 AVLTELRSGPNAKIMTFGSYACEEVSSSFHVHEGKVRIVSRYWEI 222 AVL + + G +++ +GS + + ++H+H GK+ ++ W I Sbjct: 206 AVLYQRQKG-TLRVIGYGSRSLTQAERNYHLHSGKLEFLALKWAI 249 >SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1984 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +1 Query: 88 AVLTELRSGPNAKIMTFGSYACEEVSSSFHVHEGKVRIVSRYWEI 222 AVL + + G +++ +GS + + ++H+H GK+ ++ W I Sbjct: 851 AVLYQRQKG-TLRVIGYGSRSLTQAERNYHLHSGKLEFLALKWAI 894 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -3 Query: 309 FICSFTAVRVVPATSAC-SIPKP 244 F +FTAVR P + AC SIPKP Sbjct: 432 FAATFTAVRAAPKSYACPSIPKP 454 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 554 NHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTL 685 N K P+ ++ + R K+ + PD+ E+++ LG +W L Sbjct: 175 NAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQL 218 >SB_21574| Best HMM Match : T-box (HMM E-Value=0) Length = 473 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 252 PKPLGGSITEDLPVSRNYPYF 190 P+ LGG I +D+P + N PYF Sbjct: 449 PQLLGGEIFDDIPYTANLPYF 469 >SB_20574| Best HMM Match : Extensin_2 (HMM E-Value=0.25) Length = 1508 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 550 PQPHQETDERVHGLVADRTQKNMRTNTGHAQRRDIKKSRTRLEDSERRRAP 702 P H+E D R H R + + R + RRD+ + + DS R R+P Sbjct: 1093 PSKHREWDARTHS----RERSSEREHHNGKSRRDLLEKKGSSRDSSRDRSP 1139 >SB_2799| Best HMM Match : rve (HMM E-Value=7.8e-26) Length = 1058 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 261 CSIPKPLGGSITEDLPVSRNYPYFPFVNVKTATNFLAGVRSKSHNFSVGS 112 CS+P+P GG+ + P S+++P F +VK+ N N+ +GS Sbjct: 929 CSLPQPTGGADVREYP-SKSHPVF---DVKSFQNMYLYSNITDSNYILGS 974 >SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) Length = 169 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 563 KRPMNAFMVWSQIERRKICEQTPDMHNAE 649 KRPMNAFM++++ R +I + P N++ Sbjct: 32 KRPMNAFMLFAKRYRLEITQAHPGKDNSQ 60 >SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) Length = 242 Score = 28.3 bits (60), Expect = 7.7 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 5/66 (7%) Frame = +1 Query: 520 HRCHTDEEE*PQ-----PHQETDERVHGLVADRTQKNMRTNTGHAQRRDIKKSRTRLEDS 684 H HTD P PH +T + HG D TQ T GH D +RTR + Sbjct: 79 HGPHTDPTRTPHGHDTDPHTDTTQTPHGHDTDPTQ----TQHGH----DTDPTRTRHRPT 130 Query: 685 ERRRAP 702 RR P Sbjct: 131 RRRHEP 136 >SB_53479| Best HMM Match : Zot (HMM E-Value=1.1) Length = 251 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 557 HIKRPMNAFMVWSQIERRKICE 622 HIK+P+NAFM++ + R K+ + Sbjct: 227 HIKKPLNAFMLYMKDMRPKVAQ 248 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 220 IFGNTAAERLRYGTSRGCWNHSDCCKTTNKL*NLE 324 +F + AA R G CWN C+ T +L N+E Sbjct: 59 VFVDKAARRAILGLGVKCWNWKRKCEWTGELSNIE 93 >SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1551 Score = 28.3 bits (60), Expect = 7.7 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = +1 Query: 124 KIMTFGSYACEEVSSSFHVHEGKVRIVSRYWEI 222 +++ +GS + + ++H+H GK+ ++ W I Sbjct: 5 RVIGYGSRSLTQAERNYHLHSGKLEFLALKWAI 37 >SB_54439| Best HMM Match : SNF (HMM E-Value=0) Length = 701 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 564 LMWLGLFFFVCVASVYGVENFYR 496 L+W+ LF + + VYG E FY+ Sbjct: 310 LLWISLFESIGIGWVYGAERFYQ 332 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,941,851 Number of Sequences: 59808 Number of extensions: 518727 Number of successful extensions: 1441 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 1360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1441 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2227723674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -