BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20290 (803 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 28 0.39 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 27 0.51 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 27 0.90 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 25 2.1 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 25 2.7 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 24 6.3 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 24 6.3 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 24 6.3 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 24 6.3 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 24 6.3 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 24 6.3 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 24 6.3 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 24 6.3 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 24 6.3 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 24 6.3 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 24 6.3 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 8.3 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 23 8.3 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 27.9 bits (59), Expect = 0.39 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 556 PHQETDERVHGLVADRTQKNMRTNTGHAQRRDIKKSRT 669 P + +ERV L +RT+K+ R + +D++K +T Sbjct: 254 PLLKINERVDALNEERTEKHNRCKLAEREMKDLEKPKT 291 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 27.5 bits (58), Expect = 0.51 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 475 PCSGLSL--SIKILYPIHRCHTDEEE*PQPHQETDER 579 P SGL L KI+ PI+ H D P+P Q ER Sbjct: 387 PDSGLLLRRGQKIMIPIYAMHHDPAHFPEPEQYRPER 423 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 26.6 bits (56), Expect = 0.90 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 481 SGLSLSIKILYPIHRCHTDEEE*PQPHQETDER 579 S L ++ P+H H D E P P Q ER Sbjct: 388 SVLEAGTAVMIPVHAIHHDPEVFPNPEQFDPER 420 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 25.4 bits (53), Expect = 2.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 505 ILYPIHRCHTDEEE*PQPHQETDER 579 IL P+ H D + P+PHQ ER Sbjct: 35 ILIPVLAIHMDPKYYPEPHQFDPER 59 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 25.0 bits (52), Expect = 2.7 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +1 Query: 487 LSLSIKILYPIHRCHTDEEE*PQPHQETDER 579 L ++ P+H H D E P P + +R Sbjct: 330 LEAGTSVMVPVHAIHRDPEHFPDPERFDPDR 360 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 6 EIKQSYELLSDSERRRA 22 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 8 EIKQSYELLSDSERRRA 24 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 8 EIKQSYELLSDSERRRA 24 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 649 DIKKSRTRLEDSERRRA 699 +IK+S L DSERRRA Sbjct: 5 EIKQSYELLSDSERRRA 21 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.4 bits (48), Expect = 8.3 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -3 Query: 666 PRFFDISALCMSG-VCSHIFLRSICDQTMNAFIGLLMWLGLFFFVCVASVYGVENFYR 496 P D+ +SG V S + S+ + I + + G+F ++ +AS+ GV+ F R Sbjct: 836 PHIADVKEQRVSGFVVSVLVGLSVVMAPILRLIPMSVLFGVFLYLGIASMSGVQLFER 893 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 279 VPATSACSIPKPLGGSITE 223 V A C IPKP+ +I E Sbjct: 32 VTAEDCCKIPKPIDNAIME 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 836,372 Number of Sequences: 2352 Number of extensions: 17875 Number of successful extensions: 87 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -