BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20290 (803 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 26 0.36 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 24 1.4 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.8 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.8 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 26.2 bits (55), Expect = 0.36 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -3 Query: 87 GAIESLSIEL-SCYLNAATVALRGDGE 10 GA+ +LS++L SC +N +T+ GD E Sbjct: 181 GALVTLSVQLLSCEVNGSTLVYIGDNE 207 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 452 QRPHIRHLLGHHFRLSKIKSPTKKNL 375 Q+ H RH+L +FR K S K L Sbjct: 4 QKEHYRHILLFYFRKGKNASQAHKKL 29 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 5.8 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -2 Query: 577 VHRSLDVVGVILLRLCGICVWGREFLSIS*DPNTGNPLDVGVKD 446 +H V GVI R+ C++G S TG P + V + Sbjct: 514 IHSGEVVTGVIGHRMPRYCLFGNTVNLTSRTETTGEPGKINVSE 557 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 5.8 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -2 Query: 577 VHRSLDVVGVILLRLCGICVWGREFLSIS*DPNTGNPLDVGVKD 446 +H V GVI R+ C++G S TG P + V + Sbjct: 514 IHSGEVVTGVIGHRMPRYCLFGNTVNLTSRTETTGEPGKINVSE 557 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,739 Number of Sequences: 438 Number of extensions: 4556 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -