BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20286 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 40 0.002 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_10949| Best HMM Match : WD40 (HMM E-Value=3.1e-10) 38 0.008 SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18) 36 0.023 SB_52865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_57418| Best HMM Match : WD40 (HMM E-Value=4.5e-15) 31 0.66 SB_6741| Best HMM Match : WD40 (HMM E-Value=0) 31 1.2 SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) 31 1.2 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 30 1.5 SB_36772| Best HMM Match : WD40 (HMM E-Value=3.8e-05) 30 2.0 SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) 30 2.0 SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) 29 2.7 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.5 SB_52308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_41590| Best HMM Match : WD40 (HMM E-Value=6.5e-13) 29 3.5 SB_26059| Best HMM Match : Exo_endo_phos (HMM E-Value=4.5e-09) 29 3.5 SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) 29 3.5 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 29 3.5 SB_7003| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-09) 29 3.5 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) 29 3.5 SB_51419| Best HMM Match : DNA_ligase_A_C (HMM E-Value=8.6) 29 3.5 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.5 SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031) 29 3.5 SB_5194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_3043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 205 VYDIAFSRAGGGRDMFA 255 VYDIAFSRAGGGRDMFA Sbjct: 123 VYDIAFSRAGGGRDMFA 139 Score = 31.9 bits (69), Expect = 0.50 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 255 SVGADGSVRMFDLR 296 SVGADGSVRMFDLR Sbjct: 140 SVGADGSVRMFDLR 153 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 37.9 bits (84), Expect = 0.008 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%) Frame = +3 Query: 279 RMFDLRHLEHSTIIYEDPQHT-PLLRLAWNKQDPNYLATIAMDACEVIILDVRVPCTPVA 455 R++D+R + T ++ H P+ L W+ +D N++AT D C V + DV+ TPV Sbjct: 403 RLWDMRRTD--TYYHQFMAHNGPVFTLDWHPEDRNWIATGGRDKC-VKVWDVQGKATPVN 459 Query: 456 RLNNHRACVNGIAWAP 503 + + V+ I W P Sbjct: 460 NIQT-ISSVSRIKWRP 474 Score = 31.9 bits (69), Expect = 0.50 Identities = 19/85 (22%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = +3 Query: 246 YVRSVGADGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLATIAMDA-CEVII 422 ++ + G D V+++D++ +T + + + R+ W Q +A+ A+ ++ + Sbjct: 436 WIATGGRDKCVKVWDVQG--KATPVNNIQTISSVSRIKWRPQKKYQIASCALLVDFDIHV 493 Query: 423 LDVRVPCTPVARLNNHRACVNGIAW 497 D+R P P A + H+ GI W Sbjct: 494 WDIRRPYIPYATFSEHKDVPTGIMW 518 >SB_10949| Best HMM Match : WD40 (HMM E-Value=3.1e-10) Length = 193 Score = 37.9 bits (84), Expect = 0.008 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 309 STIIYEDP-QHTPLLRLAWNKQDPNYLATIAMDACEVIILDVRVPCTPVARLNNHRACVN 485 +TII D H ++ WNK+D N LAT + D +V I D+R TPV + H + ++ Sbjct: 29 NTIISLDLCNHLGASQVKWNKEDRNVLAT-SHDG-DVRIWDLRKGNTPVVYITAHLSKIH 86 Query: 486 GIAWA 500 G+ W+ Sbjct: 87 GVDWS 91 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/73 (28%), Positives = 37/73 (50%) Frame = +3 Query: 243 RYVRSVGADGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLATIAMDACEVII 422 R V + DG VR++DLR ++ ++Y + + + W++ LAT + DA V + Sbjct: 52 RNVLATSHDGDVRIWDLRK-GNTPVVYITAHLSKIHGVDWSRTSGTALATCSNDA-SVKL 109 Query: 423 LDVRVPCTPVARL 461 + P P A+L Sbjct: 110 WNTENPRQPEAKL 122 >SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18) Length = 736 Score = 36.3 bits (80), Expect = 0.023 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +1 Query: 34 CAPLTSFDWNEVDPNLIGTSSIDTTCTIWGLETGQVLGRVNEVSGHV-KTQLIAHDKEVY 210 C +T+ W+ P+ + TSS D + +W +ET Q + GHV + + Sbjct: 22 CGRVTALSWSPHHPDRLVTSSYDGSAQVWDVETNQPIANYR---GHVGRVMSVCWSYLDP 78 Query: 211 DIAFSRAGGGRDMFAPW 261 D+ FS GG PW Sbjct: 79 DVVFS--GGEDGTVRPW 93 >SB_52865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = -2 Query: 246 ISPPAGPTERYVVHFLIMSDQLSLHVPRHFIDPAQDLSSLQAPDGAGRVNTTGA 85 ++PP+GP R+ H ++ D + + + + P D+ S + P G VN TGA Sbjct: 402 LAPPSGPRGRFS-HLGLVRDSVMMVLGGYAGMPLGDMMSYKLPQGVAVVNQTGA 454 >SB_57418| Best HMM Match : WD40 (HMM E-Value=4.5e-15) Length = 365 Score = 31.5 bits (68), Expect = 0.66 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 40 PLTSFDWNEVDPNLIGTSSIDTTCTIWGL 126 P+TS +W+ D ++ SS D T+W L Sbjct: 277 PITSVEWHPTDGSVFAASSADNQITLWDL 305 >SB_6741| Best HMM Match : WD40 (HMM E-Value=0) Length = 714 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 79 LIGTSSIDTTCTIWGLETGQVLGRVNEVSGHVK 177 L+ T+S D+T +W LETG+ L + +G V+ Sbjct: 70 LMATASTDSTLMLWNLETGECLAVLEGHTGAVR 102 >SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) Length = 198 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 79 LIGTSSIDTTCTIWGLETGQVLGRVNEVSGHVK 177 L+ T+S D+T +W LETG+ L + +G V+ Sbjct: 70 LMATASTDSTLMLWNLETGECLAVLEGHTGAVR 102 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 30.3 bits (65), Expect = 1.5 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 1/101 (0%) Frame = +3 Query: 249 VRSVGADGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLATIAMDACEVIILD 428 V S DG+VR FDL + + P+ LA + +A + D E+ + Sbjct: 1308 VLSASLDGTVRAFDLNRYRNFR-TFASPRPAQFSTLALDSSG-EVVAAGSRDTFEIFVWS 1365 Query: 429 VRVPCTPVARLNNHRACVNGIAWAP-HSLVTSAPPETTTRL 548 ++ + L H A V+ +A++P H ++ S + T RL Sbjct: 1366 IQTG-RLLEVLAGHEAPVSSLAFSPSHPVLISGAWDKTVRL 1405 >SB_36772| Best HMM Match : WD40 (HMM E-Value=3.8e-05) Length = 788 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/43 (23%), Positives = 26/43 (60%) Frame = +1 Query: 70 DPNLIGTSSIDTTCTIWGLETGQVLGRVNEVSGHVKTQLIAHD 198 D +L+ ++S D + +W + TG+++ + + ++ + L+A D Sbjct: 349 DGSLVVSASSDNSVNLWNVATGRLVRSIEKAGENISSVLVAKD 391 >SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) Length = 292 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 444 TPVARLNNHRACVNGIAWAPHSLVTSA 524 TP+ + + H A V I+W+PH + A Sbjct: 179 TPIQQYSEHTAAVKAISWSPHQVCNLA 205 >SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = +1 Query: 10 NNNKNSDFCAPLTSFDWNEVDPNLIGTSSIDTTCTIWGLETGQVLGRVN--EVSGHVKTQ 183 N K + P+ WN D N+I ++S D + IW + + +N + GH++ Sbjct: 78 NQPKVNGHTRPVLDLGWNPFDDNVIASASEDCSIKIWYIPDCGLCEDLNREDFIGHLQ-- 135 Query: 184 LIAHDKEV 207 HD++V Sbjct: 136 --GHDRKV 141 >SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 58 WNEVDPNLIGTSSIDTTCTIWGLETGQVLGRV 153 WN + P+++ ++S D T IWG T + G + Sbjct: 255 WNPLVPSMMASASDDGTVRIWGPSTEETSGNL 286 >SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) Length = 1292 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 88 TSSIDTTCTIWGLETGQVLGRVNEVSGHV 174 TSS D TC +W +ET Q + + +G V Sbjct: 88 TSSGDMTCALWDIETAQTISTYSGHTGDV 116 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 420 GLVNACHVTSGLSDHSAVLFEVDLAPKYIPKP 451 >SB_52308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -3 Query: 269 VGAHGANISRPPPALLNAMSYTSLS*AIN*VFTCPDTSL-TLPKTCPVSKPQ 117 +G HGA R PA+++ LS + C DT L PK P++K Q Sbjct: 423 LGPHGALFFRTDPAIISLPFDACLSSGDQVICMCSDTGLGETPKWEPINKTQ 474 >SB_41590| Best HMM Match : WD40 (HMM E-Value=6.5e-13) Length = 242 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 73 PNLIGTSSIDTTCTIWGLETGQVLGRVNEVSGHVKTQLIA 192 P+L+ TSS D IW +TG + +N H T +A Sbjct: 187 PSLVATSSYDGCVKIWNADTGHMSCLLNTNKYHSNTAGVA 226 >SB_26059| Best HMM Match : Exo_endo_phos (HMM E-Value=4.5e-09) Length = 334 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 236 GLVNACHVTSGLSDHSAVLFEVDLAPKYIPKP 267 >SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) Length = 895 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 420 GLVNACHVTSGLSDHSAVLFEVDLAPKYIPKP 451 >SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) Length = 843 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 255 GLVNACHVTSGISDHSAVLFEVDLAPKYIPKP 286 >SB_7003| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-09) Length = 378 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 249 GLVNACHVTSGLSDHSAVLFEVDLAPKYIPKP 280 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G Q+CH+ + DH A++++I P+ P Sbjct: 1247 GLIQACHVTSGLSDHGAVLFEIDSSPKYTPKP 1278 >SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) Length = 748 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 323 GLVNACHVTSGLSDHSAVLFEVDLAPKYIPKP 354 >SB_51419| Best HMM Match : DNA_ligase_A_C (HMM E-Value=8.6) Length = 291 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 38 GLVNACHVTSGLSDHSAVLFEVDLAPKYIPKP 69 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G +CH+ + DH A+++++ P+ I P Sbjct: 293 GLVNACHVTSGLSDHSAVLFEVDLAPKYIPKP 324 >SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031) Length = 753 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 497 GAAQSCHICTAGDDHQALIWDIQQMPRAIEDP 592 G Q+CH+ + DH A++++I P+ P Sbjct: 425 GLIQACHVTSGLSDHGAVLFEIDSSPKYTPKP 456 >SB_5194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 70 DPNLIGTSSIDTTCTIWGLETGQVLGRVNEVSGHVKTQLIAHDKEVYDIA 219 D L+ T+S D T T W L+ + V+E + T +HD +++ A Sbjct: 103 DDRLMSTTS-DGTITCWDLDNWSHMKSVDEPHNEISTLDFSHDGKIFATA 151 >SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 28.7 bits (61), Expect = 4.7 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 1/99 (1%) Frame = +3 Query: 255 SVGADGSVRMFDLRHLEHSTIIYEDPQHTPLLR-LAWNKQDPNYLATIAMDACEVIILDV 431 SV D + ++D R + + HT + L++N LAT + D V + D+ Sbjct: 293 SVADDHKLMIWDTRQTNSNKAAHTVDAHTAEVNCLSFNPYSEFILATGSADKT-VALWDL 351 Query: 432 RVPCTPVARLNNHRACVNGIAWAPHSLVTSAPPETTTRL 548 R + +H+ + + W+PH+ A T RL Sbjct: 352 RNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRL 390 >SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 70 DPNLIGTSSIDTTCTIWGLETGQVLGRVNEVSGHVK 177 D + T+S D +W +E G+V V E SGH K Sbjct: 252 DSQYLVTASSDNLARLWNVEAGEV---VREYSGHQK 284 >SB_3043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 123 APDGAGRVNTTGANEVRIHFVPIKGCKRSTEVRILI 16 AP +VNT G E + + +GCK T+ + L+ Sbjct: 368 APAQGDKVNTAGCGETKGCYAEPQGCKDHTDCKYLV 403 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 70 DPNLIGTSSIDTTCTIWGLETGQVLGRVNEVSGHVKTQLIAHD 198 D I +SS D T IW +ET + ++ GHV+ I D Sbjct: 801 DSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSD 843 >SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/27 (37%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 306 HSTIIY-EDPQHTPLLRLAWNKQDPNY 383 HS +++ + P P ++ W+KQDPN+ Sbjct: 156 HSAVLHCQAPDSYPDRQIQWSKQDPNF 182 >SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -3 Query: 458 PGHRGAGHAHVQYDHLARVHGDGGQVVRVLLVPGQAEQRGV 336 PG GAG +++ + R + + +VV+ + PG +E +G+ Sbjct: 196 PGRVGAGRRLAKWNRINRANKEALRVVQSPVAPGPSEPQGL 236 >SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 375 PNYLATIAMDACEVIILDVRVPCTPVA 455 P Y A + +DAC ++ + PCTP A Sbjct: 1292 PKYRARLVLDACTLLSILNSKPCTPGA 1318 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,604,643 Number of Sequences: 59808 Number of extensions: 513469 Number of successful extensions: 1426 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1425 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -