BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20286 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 3.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 8.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.3 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 524 CRCDKTVRRPGDAVDARPVVV 462 CR DK R PG+ P+ V Sbjct: 21 CRYDKMTRPPGEINSINPINV 41 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 120 PDGAGRVNTTGANEVRIHF 64 PD + + T A VRIHF Sbjct: 229 PDSSSELATRLAEAVRIHF 247 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 575 AASAVCPRSEPGGRLRRCRCDKTVRRPGDAVDA 477 A+ A ++EPG + K V PG+ + + Sbjct: 888 ASQATSVKAEPGSIMAMSESSKKVLSPGELLSS 920 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,562 Number of Sequences: 438 Number of extensions: 3920 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -