BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20283 (801 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC530.11c |||transcription factor |Schizosaccharomyces pombe|c... 27 3.1 SPAPB8E5.07c |||ribosome biogenesis protein Rrp12|Schizosaccharo... 25 9.5 >SPBC530.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 819 Score = 27.1 bits (57), Expect = 3.1 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +3 Query: 273 KSKVTLELFCGIRSSSPELFTNRDPSSPPM--KKALQILNLAHYEIPGRRFVWIWQLNDP 446 K+ E G + SSP+ FTN +P++ P+ + A + + Y I R V IW Sbjct: 383 KAHAVTETLTG-KPSSPDSFTNANPTTAPIVSRNAQDNMGMLAYMI---RMVSIWGRVVR 438 Query: 447 SLENYDYVQ 473 L++Y Q Sbjct: 439 CLKSYSQKQ 447 >SPAPB8E5.07c |||ribosome biogenesis protein Rrp12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1163 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 391 ARFRICKAFFIGGDEGSLLVNSSGDDERMPQNNSN 287 AR + + F +EG LL+N S +DE + + +N Sbjct: 1058 ARKQKLNSAFKSNEEGRLLINDSDEDELIEDSLAN 1092 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,186,032 Number of Sequences: 5004 Number of extensions: 63834 Number of successful extensions: 148 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -