BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20279 (772 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 97 1e-22 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.2 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 9.6 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.6 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 97.5 bits (232), Expect = 1e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +2 Query: 578 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 715 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 46 Score = 39.5 bits (88), Expect = 3e-05 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 717 CGIHETTYNSIMKCD 761 CGIHETTYNSIMKCD Sbjct: 47 CGIHETTYNSIMKCD 61 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 585 PPLHPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPR 698 PP + + P S LS T ++A+ L PR Sbjct: 678 PPARSPSSQAQASQCPQTASLLSSTHSTLARSLMEGPR 715 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 4.2 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +2 Query: 326 AVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRP 457 ++ +++HR C P +L +I + P HP + S S P Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 386 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 294 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = -2 Query: 756 TS*WSYMWSRGCRKASIPKNEGWKR 682 +S W ++ + IPK+ GW++ Sbjct: 197 SSEWDSDYTDKSNEKKIPKSSGWRK 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 250,910 Number of Sequences: 438 Number of extensions: 6037 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -